Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115598-GRMZM2G379758
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100272475

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.85661209927339
Log2 mRNA fold difference:-0.69456894858854
Log2 TE fold difference:-0.15800618907502
Sequences
Protein sequence

MASRFWGQGDSESEEEEVEEVESEQGSDSDDDGGRGGAGRGAQNRYLKNQEDDSDESDTG
HRVIRSLRDKRNEEMRSIVDQMRNAMKINDWVSLQESFEKLNKHLEKVVRVNESTEVPKM
YIKALVLLEDFLAEALANKEAKKKMSSSNSKAFNAMRQKLKKNNKQYEEQIQKCREHPES
FEDEAADDKDTDDDDVDESDAEIEDPDKIAMSESEEEQDEEDDDKDGWEQKRSKKDKLMD
KQFLKDPSEITWDIVDKKLKEIVASRERKFDVNPSLLGHMPVNVWKKCVNNMLLVLDILQ
QYPNIVVDTSFEPDENETQKGADYNGTIHVVGDLVAFLERLDSEFLKTLQCTDPYTKDYV
QRLREEPLFLVVAQNVQDYLERVGNFKAAAKVALRRVELVYYKPQEVYDAMRKLAEQPED
CVDDDDAEAGDEHKAVDDNRGPSPFVVIPEAVHRKPTFPESGRTLMDGLMFLIYKYGDER
TKARAMLCDIYHHAISDEFSVARDLLLMSHLQDGIQLMDISSQILFNRVMAQLGLCAFRA
GLINEAHGCLTELYSTGRVKELLAQGVQQSRYHEKTPEQERLERRRQMPYHMHINLELLE
ATHLICAMLIEVPNMAASTYDKRRPMSKTFRRLLEVSERQTFVGPPENVRDHVMAATRAL
NKGDHQKAFSVINSLEIWKLLRNREHVLEMLKLKIKEEALRTYLFSYSSSYESLSLNQLT
TMFDLSEQHAHSIVSKMMMHEELHASWDQPTKCIVFHSVDQTRLQGLLFQMADKLSVLVE
INERAYEARTGGALEGVPPRRRGEGQDNMGKWQDNFVSSQGRQGGGNRFGYSSRGAVSGQ
SGGGHQRDRGNQGYRGGYGGVSRFQDARGRNQSNPSGRGGDGGARMVNLNRVGRV*

MASRFWGQGDSESEEEEVEEVESEQGSDSDDDGGRGGAGRGAQNRYLKNQEDDSDESDTG
HRVIRSLRDKRNEEMRSIVDQMRNAMKINDWVSLQESFEKLNKHLEKVVRVNESTEVPKM
YIKALVLLEDFLAEALANKEARKKMSSSNSKALNAMRQKLKKNNKQYEEQIQKCREHPES
FEDEAADDKDVDDDDADESDAEIEDPDKIAMSESEEEQDEEDDDKDGWEQKRSKKDKLMD
KQFLKDPSEITWDIVDKKLKEIIASRGKKGTGRIERVEQLTFLTRVAKTPAQKLEILFHV
ISAQFDVNPSLLGHMPVNVWKKCVNNMLLVLDILQQYPNIVVDTSFEPDENETQKGADYN
GTIHVVGDLVAFLERLDSEFLKTLQCTDPYTKDYVQRLREEPLFLVVAQNVQDYLERVGN
FKAAAKVALRRVELVYYKPQEVYDAMRKLAEQPEDCVDDDDAEAGDEHKAVDDNRGPSPF
VVIPEAVHRKPTFPESGRTLMDGLMFLIYKYGDERTKARAMLCDIYHHAISDEFSVARDL
LLMSHLQDGIQLMDISSQILFNRVMAQLGLCAFRAGLINEAHGCLTELYSTGRVKELLAQ
GVQQSRYHEKTPEQERLERRRQMPYHMHINLELLEATHLICAMLIEVPNMAASTYDKRRP
MSKTFRRLLEVSERQTFVGPPENVRDHVMAATRALNKGDHQKAFSVINSLEIWKLLRNRE
HVLEMLELKIKEEALRTYLFSYSSSYESLSLNQLTTMFDLSEQHAHSIVSKMMMHEELHA
SWDQPTKCIVFHSVDQTRLQGLLFQMADKLSVLVEINERAYEARTGGTLEGVPPRRRGEG
QDNMGKWQDNFVSSQGRQGGGNRFGYSGRGAISGQSGGGHQRDRGNQGYRGGYGGVSRFQ
DARGRNQSIPSGRGGDGGARMVNLNRMGRV*

Other information
Ka divergence:-0.0521327KaKs divergence:0.187385
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2688Length 2 (bp):2793Length divergence:0.019
MFE 1 (kcal):-852.45MFE 2 (kcal):-889.44MFE divergence0.021