Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115701-GRMZM2G176340
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273859
Function (paralog2):hypothetical protein LOC100191954

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.51136459828623
Log2 mRNA fold difference:-0.36066203219771
Log2 TE fold difference:0
Sequences
Protein sequence

MSLKSIVRELKEMRDGIGSMSRRGGSGSDGRAAGHARSGSRHSWPSLWAEQQQPQRQGQG
QGLGQEGPRHQHQGRWADLPPELLLDVIQRVESSEATWPARRQVVACAAVCRSWREVTKD
VVKTLEECGRITFPISLKQPGPRELPVQCFVRRERATSTYLLYLGLSPSMNVENDKLLLA
ARKVRRATRTSFVISLVSDDFSRSSSTYVGKLKPNFLGTKFTIFDSQPPPDAVALPNNRP
SKRQSKQVSPRLPLGNYNVATVTYELTVLRNRGPRRMQCTMHSIPAECIQEGGKAPTPTG
TVQSLDEPVPTLPSTTKGKEVAVQFSSTSLSADLSGPVSGNEAPLVLKNKAPRWHEQLQC
WCLNFRGRVTVASVKNFQLVASVDPSLNVPAAEQEKVILQFGKIGKDIFTMDYRYPLSAF
QAFAICLTSFDTKPACE*

MSLKSIVRELKEMRDGIGSMSRRGGSGSDGRAFHGRSGSRHSWPSLWAEQQQSHRQGQGL
GPGPEGPHHQHQGRWANLPPELLLDVIQRVESSEATWPARRQVVACAAICRSWREVTKEV
VKTLEECGRITFPISLKQPGPREMPVQCFVRRERATSTYLLYLGLSPSMNVEKDKLLLAA
RKVRRATRTYFVISLVSDDFSHSSSTYVGKLKPNFLGTKFTIFDSQPPPDAVVLPNNKTS
KRQSKQVSPRLPLGNYNVATVTYELTVLRNRGPRRMQCTMHSIPAECIQEGGKAPTPTGA
IQSLDEPVSSTLPSAKGKEVAVEFSSTSLSADLSGPACVNGTPLVLKNKAPRWHEQLQCW
CLNFRGRVTVASVKNFQLVASVDPSLNIPAAEQEKVILQFGKIGKDIFTMDYRYPLSAFQ
AFAICLTSFDTKPACE*

Other information
Ka divergence:-0.0815782KaKs divergence:0.117195
GC content 1 (%):61GC content 2 (%):57GC content divergence:-0.034
Length 1 (bp):1314Length 2 (bp):1311Length divergence:-0.001
MFE 1 (kcal):-564.6MFE 2 (kcal):-523.05MFE divergence-0.038