Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115839-GRMZM2G401026
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191965
Function (paralog2):hypothetical protein LOC100275407

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.26756128958883
Log2 mRNA fold difference:-0.63765614134379
Log2 TE fold difference:0.79502406813133
Sequences
Protein sequence

MAAPPTVRGYGPASPSSSVALPRARSRVPASLVPVPTRRAPSVRLRAAVADVPRGGLQLQ
RREVEVLSGTVFGREEDEVLEKVGEEKVDGWIRESIAEIVRHIGEAPFLVHLFSSGDGDG
EHVTVRRETAAPESWPDVRRRWGMGGQRRPDGVILVEQVAAVAVDGGASASEAARQVWGL
VVQARGMEHASCYVLDTCRVRSSAGFCTHFCLARAKCFGDPVELQLRNAWLNRLAGRR*

MAAAPTVRGYGPASPSSSSVALPRPRSRVPAPLVPVTTRRGAPSVRLRAAGADTPPRGGL
QLQRREEDEGLPGTVLGRGEDDEVSEKVGEEKVERWMRDSIAEIVRHVGEAPFLVHLFSS
GEGERVTVRREPAAPESWPDVRRRWGPGGARRPDGIILVEQVASDGGGASAASEAARQVW
GLVVQARGMERASCYVLSTCRVRSSAGFCTHFCLARAQCFGDPVELQLRNAWLNRLAGRR
*

Other information
Ka divergence:0.0875803KaKs divergence:0.375614
GC content 1 (%):74GC content 2 (%):76GC content divergence:0.013
Length 1 (bp):717Length 2 (bp):723Length divergence:0.004
MFE 1 (kcal):-412.7MFE 2 (kcal):-443.2MFE divergence0.036