Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115921-GRMZM2G033352
Species:maize
Duplication type:WGD
Function (paralog1):TRAF type zinc finger domain containing 1
Function (paralog2):TRAF type zinc finger domain containing 1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAAAADSDTAAAVGAMSTCAHCQREIPFLNIDLHSVHCARNLQKCQHCGEMIPRKLMDE
HYDENHAPINCSLCKETIERESWDLHKGEKCPQRIVACEYCEFELPAVDLHEHQDVCGNR
TELCQTCRKYIRLREWTGHEIQCHTNSNGSADTSRAIPERELRPPPPPVRQARPARPAHA
SPHKRLLFTIAVTGIAVMIGSILFQRDEGF*

MAAAAADSDPAAAVADMSTCAHCQREIPSSNIDLHSVHCARNLQKCQHCGEMIPRKLMDE
HYDANHAPISCSLCKETIERVRWDLHKGEKCPQRIVACEYCEFELPAVDLHEHQDVCGNR
TELCQTCRKYIRLCEWIGHEIQCHTSSNGSADTSSARAIPERELRPPPPVRPARPARPAH
ASPHKRLLFTIAVTGIAVMVGSILFQRDESF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):633Length 2 (bp):636Length divergence:0.002
MFE 1 (kcal):-194.74MFE 2 (kcal):-200.86MFE divergence0.015