Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115939-GRMZM2G102421
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC542170
Function (paralog2):NEDD8-conjugating enzyme Ubc12-like

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MINLFKIKGQKKDEAASATGKAPVKKQSAGELRLHKDISELNLPKTTSISFPNGKDDLMN
FEITIRPDEGYYMGGAFVFTFQVSPSYPHDPPKVKCKTKVYHPNIDLEGNVCLNILREDW
KPVLNINTVIYGLNLLFTQPNDEDPLNHEAAAVLRGNPKMFEANVKRAMTGGYVGQHYFQ
RCLA*

MINLFKIKGQKKEEAASAAGKAPVKKQSAGELRLHKDISELNLPKTTSISFPNGKDDLMN
FETTIRPDEGYYMGGTFVFTFQVSPSYPHDPPKVKCKTKVYHPNIDLEGNVCLNILREDW
KPVLNINTVIYGLNLLFTQPNDEDPLNHEAAVVLRDNPKMFEANVRRAMAGGYVGQHYFQ
RCA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):555Length 2 (bp):552Length divergence:-0.003
MFE 1 (kcal):-149.16MFE 2 (kcal):-146.17MFE divergence-0.01