Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116034-GRMZM2G027995
Species:maize
Duplication type:WGD
Function (paralog1):translation initiation factor
Function (paralog2):Eukaryotic initiation factor 4A (eIF-4A)(EC 3.6.4.13)(ATP-dependent RNA helicase eIF4A)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG
FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE
LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILGSGVHVVVGTPGRVFDMLRRQSLR
PDNIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKIQVGVFSATMPPEALEITRKFMNKPV
RILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKM
RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQ
PENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL*

MAGMAPEGSQFDAKHYDSKMQELLSTGETEEFFTSYDEVFESFDDMGLQENLLRGIYAYG
FEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGILQQLDYGLVECQALVLAPTRE
LAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLR
PDNIKMFVLDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPV
RILVKRDELTLEGIKQFYVNVDKEDWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKM
RSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQ
PENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVLIEELPANVADLL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):1245Length 2 (bp):1245Length divergence:0
MFE 1 (kcal):-449.61MFE 2 (kcal):-423.6MFE divergence-0.03