Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116087-GRMZM2G124365
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100279511

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.7669869375412
Log2 mRNA fold difference:2.8714181392969
Log2 TE fold difference:-1.1243476015072
Sequences
Protein sequence

MATTAQLAGTGTARSAQGPPNQKRSDPRSLAKPSSSRSVPPFKLVTKPAAASPAAAHWGD
LARGPQGTSRVAFGPAPRNKGLRTANNSATPMAKEERVDRSEILTLDSIRQVLIRLEDSI
IFGLLERAQFCYNADTYDSNAFHMDGFGGSLVEYMVRETEKLHAQVGRYKSPDEHPFFSK
DLPEPQLPPMQYPRVLHPIADSININKEIWTMYFDELLPRLVKEGSDGNAGSNALCDTTC
LQALSKRIHYGKFVAEAKFQESPEAYTPAIIAQDRDQLMRLLTYETVERAVEHRVEAKAK
IFGQEVNIGAKDNGSQPVYKIRPSLVAELYSYRIMPLTKEVEVAYLLRRLD*

MAFKLITKPAAASPAAAYWGDLARGPQGTSRVAFGPAPRNKGLRAANNSATPIAKVERVD
RSDILTLDSIRQVLIRLEDSIIFGLLERAQFCYNADTYDSNAFHMDGFGGSLVEYIVRET
EKLHAQVGRYKSPDEHPFFSKDLPEPRLPPMQYPRVLHPIADSININKEIWKMYFDELLP
RLVKEGSDGNAGSSALCDTTCLQALSRRIHYGKFVAEAKFQESPEAYTPAIIAQDRDQLM
NLLTYETVERAIEHRVEAKAKIFGQEVNIGAKDNGSPPVYKIRPSLVAELYSYRIMPLTK
EVEVAYLLKRLD*

Other information
Ka divergence:-0.0259537KaKs divergence:0.842915
GC content 1 (%):52GC content 2 (%):50GC content divergence:-0.02
Length 1 (bp):1056Length 2 (bp):939Length divergence:-0.059
MFE 1 (kcal):-363.64MFE 2 (kcal):-309.39MFE divergence-0.081