Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116140-GRMZM2G048430
Species:maize
Duplication type:WGD
Function (paralog1):ripening-related protein
Function (paralog2):LOC100283824

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MARPRSVAAAAAAPLLLLLAAAAAGLVSAASPAASDFVRKSCRTTQYPSVCEQSLASYGG
SPPPRSPRELARAALSVSADRARAASAYVGRLCGASNGKGAKKGSGSGSGSASAGPVRDC
LDNLADSVGHLRDAAQEMGGAGMGRAGTPAFRWHLSNVQTWCSAALTDEDTCLDGLSSRA
VDAGTRAAIRGKVVEVAQVTSNALALVNKVGPGY*

MARPCRSSSSAAARLLLLLAAVAAALQAAAATPPVASGFIRKSCRATQYPSVCEQSLAAY
GGSPPPRSPRELARAALAVSADRARAASAYVGRLCGSRSGSGDGSPRRGAGAGAKKGSAA
AGPVRDCLENLADSVGHLRDAAQEIGGAGMARAGTRAFRWHLSNVQTWCSAALTDENTCL
DGLSSRAVDAATRAAVRGRVVEVAQVTSNALALVNKVGPGY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):75GC content 2 (%):76GC content divergence:0.007
Length 1 (bp):645Length 2 (bp):666Length divergence:0.016
MFE 1 (kcal):-362.8MFE 2 (kcal):-381.1MFE divergence0.025