Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116586-GRMZM2G161493
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382378
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.68382180189696
Log2 mRNA fold difference:0.48102467326596
Log2 TE fold difference:0.1977458689225
Sequences
Protein sequence

MASGADAAALVTSGADEWAAACPPLRRNLQLLAPDEVELAKMLLNEGQIHLFEHWPEPGI
DDDKKRGFFDQVRRLNSSYPGGLVSYIKNAKKLLADSKAGKNPYDGFTPSVPSGEILNFG
DDNFVSLEAAGIKEAHNAAFVLVAGGLGERLGYKGIKVALPRETTTGKCFIQHYIESILV
LQEASCKTVDDGCQKKIPFVIMTSDDTNALTIKLLESNSYFGMEPSQVKLLKQEKVACLA
DNDARLALDPSDKYKIQTKPHGHGDVHSLLYSSGLLEQWKSEGRKWVLFFQDTNGLLFNA
IPSALGVSATKGYNVNSLAVPRKAKEAIGGITKLTHVDGRTMVINVEYNQLDPLLRATGY
PDGDTNSETGYSPYPGNINQLILELGPYIEELKKTHGAISEFVNPKYTDSTKTSFKSSTR
LECMMQDYPKTLPPSTKVGFTVMDTWLAYAPVKNNPEDAAKVPKGNPYHSATSGEMAIYR
ANSLILRKAGAQIADPVVDTFNGQEVEVWPRVTWSPRWGLTFQSVKEKVHGSCSVSQRSA
LVIDGRSVFLDGLSLDGTLIVNAVDGAEVKVTGHVENKGWTIRHVDYKDTSEKEEVRIRG
FKFNKSEQLEVNYTEPGKHSLSA*

MAPGTDAGYGQWAAACPPLRRNLQLLSPDEVELAKMLLNEGQIHLFEHWPEPGVDDDNKR
GFFDQVRRLNSSYPGGLVSYIQNAKKLLADSKEGKNPYDGFTPSVPSGEVLTFGNDNFVS
LETAGIKEACNAAFVLVAGGLGERLGYKGIKVALPRETTTGKCFLQHYIESILAFQEASC
KMVDEGCQTKIPFVIMTSDDTNALTIKLLESNSYFGMEPSQVKILKQEKVACLADNDARL
ALDPSDKYKIQTKPHGHGDVHSLLYSSGLLEQWKTEGRKWVLFFQDTNGLLFNAIPSALG
VSATKGYNVNSLAVPRKAKEAIGGITKLTHVDGRTMVINVEYNQLDPLLRATGHPDGDSN
CETGYSPYPGNINQLILELGPYIEELKKTHGAISEFVNPKYTDSTKTAFKSSTRLECMMQ
DYPKTLPPSAKVGFTVMDTWLAYAPVKNNPEDAAKVPKGNPYHSATSGEMAIYRANSLIL
RKAGAQIADPVVHTFNGQEVEVWPRVTWSPRWGLTFKSVKEKVHGNSSVSQRSALVINGQ
NVFLEGLSLDGTLVVNAADEAEVKLTGHIQNKGWTIQHVDYKDASEKEEIRIRGFKLEKI
EQLEVNYTEPGNHSLSA*

Other information
Ka divergence:-0.0659264KaKs divergence:-0.015625
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1872Length 2 (bp):1854Length divergence:-0.005
MFE 1 (kcal):-630.7MFE 2 (kcal):-601.94MFE divergence-0.023