Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116620-GRMZM5G879278
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276089
Function (paralog2):hypothetical protein LOC100274081

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.4902132854482
Log2 mRNA fold difference:0.21133576048547
Log2 TE fold difference:0.28613110419426
Sequences
Protein sequence

MERPAPVRKSHTSTADLLVWPEGAPQELPAGSTPPSNRRPHQPSEALRKVVFGGQVTEAE
AESLNKRKPCSAPKWKEMTGSGIFAAGGEGEEDESANVSATSVRTAPKNYQAISTISHIS
FAEEESISPKKPTSISEVAKQRELSGTLLSEDDSKMKRQISDLKSKELSGHDIFAPPEDP
RPRNSENGSTSQTPGKNAHVSNFKFGEADEDSAVKTAKKIPTKKFTDLAGNIFKGDDEAP
GTAEKHHLSTAKLKEMTGSDIFADGEAPSRDYLGGIRKPPGGESSIALV*

MERPAPVRKSHTSTADLLIWPEGAPQESPAGATPPSNRRPHQVSAFLSLPHWAPQVHWLI
CGRTSPCLNLSVLCSVQPSEALRKVVFGGQVTEEEAESLNKRKPCSAPKWKEMTGSGIFA
AGGEAEEDESANASATPIRTAPKNYQAISTISHISFSEEESISPKKPTSIAEVAKQRELS
GTLLSEDDSKMKKQISDLKSKELSGHDIFAPPEDPRPRNSENGSTSQTPGKNAHVSNFKF
GEADEDGMVKTAKKIPTKKFTDLAGNIFKGDETPPGTAEKHLSTAKLKEMTGSDIFADGK
APSRDYLGGIRKPPGGESSIALV*

Other information
Ka divergence:-0.522079KaKs divergence:-0.580506
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):870Length 2 (bp):972Length divergence:0.055
MFE 1 (kcal):-352.2MFE 2 (kcal):-395.44MFE divergence0.058