Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G116872-GRMZM2G006672
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100274026

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MARRSTPLLRRLLAPSPSPSASTPLAGAVSRRTVTYMPRPGDGAPRGVTLIPGDGIGPLV
TGAVRQVMEAMHAPVYFETYEVRGDMPTVPAEVIESIRRNKVCLKGGLATPVGGGVSSLN
MQLRKELDLYAALVNCFNLPGLPTRHDNVDIVVIRENTEGEYSGLEHEVVPGVVESLKVW
KIPCIALPLLM*

MARRSTPLLRRLLAPSPSLPTPLADAVSRRTVTYMPRPGDGAPRGVTLIPGDGIGPLVTG
AVRQVMEAMHAPVYFETYEVHGDMPTVPAEVIESIRRNKVCLKGGLATPVGGGVSSLNVQ
LRKELDLYAALVNCFNLPGLPTRHDNVDIVVIRENSEGEYSGLEHEVVPGVVESLKVITK
FCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVAKKYPGIKYNEIIVD
NCCMQLVAKPEQFDVMVTPNLYGNLVANVAAGIAGGTGVMPGGNVGQDHAIFEQGASAGN
VGNEKIVEKKRANPVALLLSSAMMLRHLQFPSFADRLETAVKRVIAEGKYRTKDLGGTST
TQEVIDAVIAKLG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):55GC content divergence:-0.091
Length 1 (bp):576Length 2 (bp):1122Length divergence:0.322
MFE 1 (kcal):-253.21MFE 2 (kcal):-437.01MFE divergence0.266