Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G117022-GRMZM2G148586
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191871

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.81838197456284
Log2 mRNA fold difference:1.5565407311685
Log2 TE fold difference:-0.74768616012025
Sequences
Protein sequence

MSAAAADWLPSASVTASGRPVLSAGEVERNLVPLVDLEPEENPHLAPLRACLLALTSHRL
IFLHEPSRSARGLPLATVVHAYPPHRRHNHNPLRSLFSSSSSSSSQHHRIRLQISMPSVR
SEVIAIVVTCKADVDVFFGRLLEAIRARAWEVAPAAAPSSSTPVADVPAENVGIRMPVVG
VSGILRMEQESWESAGQNLQDAFQDLNALMGKAKEMMQLAEKMRLKLLMNSSTESNSNDE
EMGSKQDMQDLLLSVGIVSPVTKETAGALYHQQLSLQLADFVRIPLEKAGGMMALVDVYC
LFNRARGTELISPEDLLQACSLWEKVDVQVMLRKFDSGVKVIQTKTHSDEEVFARISSLA
QKQDALQKGISPSDAAFTLGIAPALAKEHLLNAENKGLLCRDVSPDGFRFFINLFNDIDA
QNIYSQKPYGPYNVWISVAMTSH*

MSAAAADWLPSASVTASGRPVLSAGEVERNLLPLVDLEPEENPRLAPLRACLLALTSHRL
IFLHEPSRSARGLPLATVVHAYPPHRRHSHNPLRSLFSAPSSSSSSQHHRIRLQISMPPV
RSEVIAIVVTCKADVDVFFGRLLEAIRARAWEVTPAAAPSSGTSVAEGAAPTEDIAIRMP
VVGVSGILRMEQESWENAGQNLQDAFQDLNALMSKAKEMMQLAEKMRLKLLMNSSTESNS
NDEEMGSKQDMQDLLLSVGIVSPVTKETAGALYHQQLSLQLADFVRIPLEKAGGMMALVD
VYCLFNRARGTELISPEDLLQACSLWEKVDVPVMLRKFDSGVKVIQTKTHSDEEVFARIS
SLAQKPDALQKGISPSDAAFTLGIAPALAKEHLLNAENKGLLCRDVSPDGFRFFSNLFND
IDPQNIHSQKPHGMYKAWISVAMASH*

Other information
Ka divergence:-0.346387KaKs divergence:-0.296806
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):1332Length 2 (bp):1341Length divergence:0.003
MFE 1 (kcal):-479.19MFE 2 (kcal):-497.22MFE divergence0.018