Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G117193-GRMZM2G168002
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274073 (LOC100274073), mRNA
Function (paralog2):hypothetical protein LOC100304352 (LOC100304352), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.34376397621078
Log2 mRNA fold difference:-0.060917902944373
Log2 TE fold difference:-0.33374466328389
Sequences
Protein sequence

MEDAKEDAAMVPWPGLALAPSCLTRHIPLPCPPIRPRAYPSIHTYAAARCRWRRNISERC
SGGVTRKEPTGRLSIRAPAQLAVASGIRSITLLLLLLLSLVGQEHTSCLLCRRRRSSRAL
SSSSRPRRDHSGGCCCLSCWPRHRRFCDTIRSAAAGTLEMSSLGGQQQHGRGDEARARLR
WTRQLHGRFVLAVAQLGGADSEFLSSKSSAHELAARACPVLSLTACLNATTTDVGFRYQN
IAEATPKSVMRAMAVSGLTLYHLKSHLQRYRLAVSQGTASPVGEGDNGGGANERSSSSES
QLDEYDDGSVADLHGDSSGSMAARVQREAKRKRHEQMQIEVQRHLQLRIEAQGRYMQSVL
RRAQEALADHILGSPATGAEAELSELASAVETGTGCLSSTSCCSTSPSPMRHRSADSCVT
SSSSSSSSEAESQAPAGANTCAGTRDCSVERPVQGEESTFLQRHEDEDEAEEADVGAAAA
AEDEDGTSSEIDLNR*

MARPGPSCCPHARRHIPPCVVLCLAADSRPRAYPYIYRRRRRQGRNISGPGGAVVESQES
KATDRRSQPAGRPIRAPARLAVASTVGRSPAELACFPAAVAAWPGPAACCRRLVCGYSGL
SCWPRHRRCDTKRRGGHVGNGIVAGSGWSAAGARARARRGQGAAQVDAPAARPLRARRGP
ARRRRQGDTQVRAEGDGRAGAHAVPPQEAPAGPSGHRRIISLLKYRLVAVSRGVASPLGD
SGDGTDERSSSSSENQPADECDDGTVAEPHGDSSRSVARMQRKLQEQIEVQRHLQLRIEA
QGRYLQSVLRRAQEVLADHGLGSAAGAEAELASAVDTGSLSSSCCCSPTRRRSADSCVTS
SSSEAESQAPVGGATWLHTCAGTRDCSVEQQPVQGEKSTFLQRHGAAEDGTSSEIDPNGN
R*

Other information
Ka divergence:0.426786KaKs divergence:-0.581822
GC content 1 (%):66GC content 2 (%):69GC content divergence:0.022
Length 1 (bp):1488Length 2 (bp):1266Length divergence:-0.081
MFE 1 (kcal):-715.3MFE 2 (kcal):-664.7MFE divergence-0.037