Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G117707-GRMZM2G365160
Species:maize
Duplication type:WGD
Function (paralog1):phospho-2-dehydro-3-deoxyheptonate aldolase 1
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.12836878057685
Log2 mRNA fold difference:-0.27016707452971
Log2 TE fold difference:0.37187159262246
Sequences
Protein sequence

MALATNSAAAAAAAVSGGAASQPHRAATFLPLKRRTISAIHAADPSKNNGPAVPAAAAAK
SSASAVATPEKNPAAPVKWAVDSWKSKKALQLPEYPNQEELDTVLKTIETFPPVVFAGEA
RHLEERMAEAAMGRAFILQGGDCAESFKEFHANNIRDTFRILLQMGAVLMFGGQVPVVKV
GRMAGQFAKPRSEPLEERDGVKLPSYRGDNVNGDDFTEKSRVPDPQRMIRAYSQSVATLN
LLRALATGGYAAMQRVTQWNLDFMDHSEQGDRYRELAHRVDEALGFMTAAGLTVDHPIMT
TTDFWTSHECLLLPYEQSLTRKDSTSGLFYDCSAHMLWVGERTRQLDGAHVEFLRGVANP
LGIKVSDKMNPSDLVKLIEILNPSNKPGRITIITRMGAENMRVKLPHLIRAVRNAGLIVT
WITDPMHGNTIKAPCGLKTRPFDSILAEVRAFFDVHDQEGSHPGGIHLEMTGQNVTECIG
GSRTVTFDDLSDRYHTHCDPRLNASQSLELAFIIAERLRKRRMRSGLNNSLPLPPLAF*

MALATNSAAAAAAVSGGVASQPRRAAVFLPLKRRTISAIHAADPSKNNGPAVPAAAGANS
SASAVATPEKKPAAHGKWAVYSWRSKKALQLPEYPNAEELDAVLKTIETFPPVVFAGEAR
RLEERMAEAAMGRAFVLQGGDCAESFKEFHANNIRDTFRVLLQMGVVLMFGGQMPVVKVG
RMAGQFAKPRSEPFEEKDGVKLPSYRGDNVNGDDFTEKSRVPDPQRMIRAYAQSVATLNL
LRAFATGGYAAMQRVTQWNLDFMDHNEQGDRYRELAHRVDDALGFMTASGLTVDHPIMTT
TDFWTSHECLLLPYEQALTREDSTSGLFYDCSAHMLWVGERTRQLDGAHVEFLRGVANPL
GIKVSDKMNPSELVKLIDILNPSNKPGRITIITRMGAENMRVKLPHLIRAVRNAGLIVTW
ITDPMHGNTIKAPCGLKTRPFDSILAEVRAFFDVHDQEGSHPGGVHLEMTGQNVTECIGG
SRTVTFDDLSDRYHTHCDPRLNASQSLELAFIIAERLRKRRMRSGLNSSLPLPPLAF*

Other information
Ka divergence:0.297563KaKs divergence:0.114511
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):1617Length 2 (bp):1614Length divergence:-0.001
MFE 1 (kcal):-652.67MFE 2 (kcal):-677.51MFE divergence0.019