Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G117823-GRMZM5G876160
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191363
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.095605439877152
Log2 mRNA fold difference:-0.1220661958243
Log2 TE fold difference:0.071173056058516
Sequences
Protein sequence

MGADSEDAVKQLSLLMEQVEAPLKRSFQNMHQGYPKETLVRFLKAREWNVPKAHKMIVDS
LDWRIENEIDSVLERPIVPVDLYRSIRDSQLIGLSGYTKEGLPVFGIGVGHSTYDKASVH
YYVQSHIQINEYRDRIILPRLTQQFERPVVRCIKVLDMTGLKLSALSQIKMLTSISTVDD
LNYPEKTETYYVVNVPYIFSACWKVVKPLLQERTKKKVKVLSGCGRDELLKIMDYSSLPH
FCRREGSGSSKHSSADVDDCYSLDHPFHKELYDHIKEQASRRELIKMGSLHVSIPEPDPE
DAKIVEVIQAEFQKIGEQDESTTGHKD*

MGADSEDAVKQLSLLMEQVEAPLKRSFQNMHQGYPKETLVRFLKAREWNVAKAHKMIVEC
LNWRIQNEIDSVLERPIVPVDLYRSIRDSQLIGLSGYTKEGLPIFGIGVGHSTYDKASVH
YYVQSHIQINEYRDRIILPRLTQQFGRPVTSCIKVLDMTGLKLSALSQIKMLTSISTVDD
LNYPEKTETYYVVNVPYIFSACWK

Other information
Ka divergence:-0.0215162KaKs divergence:0.00794022
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):984Length 2 (bp):612Length divergence:-0.233
MFE 1 (kcal):-307.66MFE 2 (kcal):-188.54MFE divergence-0.24