Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G117942-GRMZM2G117971
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized proteinWin2 ;
Function (paralog2):hypothetical protein LOC100191593

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.062185743062446
Log2 mRNA fold difference:-1.0475023851471
Log2 TE fold difference:0.98661007632076
Sequences
Protein sequence

MAGMTVGNKLALAAVLLCAAAAMATAQQASGVRATYNFYNPQQNNWDLNAVSAYCATWDA
SKPLSWRMKYGWTAFCGPAGPTGQAACGQCLLVTNTATGASITVRIVDQCSNGGLDLDYD
TAFKPIDTNGQGFQAGHLTVNYQFVNCGDN*

MAGMRVGKLALAAVLLCAAAAMATAQQASGVRATYNFYNPQQNNWDLNAVSAYCATWDAS
KPLSWRMKYGWTAFCGPAGPTGQAACGQCLLVTNTATGASITVRIVDQCSNGGLDLDYDT
AFKPIDTNGQGFQAGHLTVNYQFVNCGDN*

Other information
Ka divergence:1KaKs divergence:1
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):453Length 2 (bp):450Length divergence:-0.003
MFE 1 (kcal):-210.12MFE 2 (kcal):-216.1MFE divergence0.014