Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118063-GRMZM2G130442
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279257
Function (paralog2):OCL5 protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.6064754745751
Log2 mRNA fold difference:1.1484917028151
Log2 TE fold difference:0.49491229321534
Sequences
Protein sequence

MTPARRMPAMIGRNNGVAFGSSSALSLSQVIIPADFLDSHHLQQAFEQQLFEQIPAAAVD
SSDNIIHGRSDALVDEFESKSCSENPDGTASGDDGQGDEDPNQRPNKKKRYHRHTQHQIE
EMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKNQHERQENAQLRAENDK
LRAENMRYKDALGTASCPSCGGPAALGEMSFDEHHLRLENARLRDEIDRISGIAAKHVGK
PMVSFPVLSSPLAARSPFDLAGAYGVQPPGGGGGLGAADHLFGGAAGDLLRSVSAGQLSA
DKSMIVELAVAAMDELLRMARVDAPLWNGGVAGVPQQLDEEEYGRTFPGGLGPRQYGLRP
EASRDDAVVIMTRDSLVEILMDANRFAAVFSSIVSRASTHEVLSTGVAGSYNGALQVMSM
EFQVPSPLVPTRESYFARYCKNNPDGTWAVVDVSLDSLRPSPALKCRRRPSGCLVQEMPN
GYSKVTWVEHVEVDDRSVHNLYRPLVNSGLGFGATRWVGTLDRQCERLASAMASNIPNGD
LGVITSIEGRKSMLKLAERMVASFCGGVTASAAHQWTTLSGSGAEDVRVMTRKSVDDPGR
PPGIVLNAATSFWLPVPPKRVFDFLRDETSRSEWDILSNGGAVQEMAHIANGRDHGNCVS
LLRVNSANSNQSNMLILQESCTDASGSYVVYAPVDVVAMNVVLNGGDPDYVALLPSGFAI
LPDGPPAPGMAPHHGGEGAAGGGLEELEAAGGSLLTVAFQILVDSVPTAKLSLGSVATVN
SLIACTVERIKAAVCGAEGNPQ*

MTPARRVPPAAMIGRNGFAFGSSSALSLSQADLLDSHQLQQAFQQQLFDQIPTTTTVDDS
SDNLIHGRSDTLVDEFESKSCSENPDGTSGDDGLEEDPNQRPNKKKRYHRHTQHQIQEME
AFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKNQHERHENAQLRAENDKLRA
ENMRYKEALGTASCPSCGGPAALGEMSFDEHHLRLENARLRDEIDRISGIAAKHVGKPMV
SFPVLSSPLAAAAAAARSPLDLAGAYGVQSAAAGLGADHVLFGAGAGDLLRSVSAGQLDA
DKPMIVELAVAAMDELLRMARPDALLWGGGASAGAQQQQLDEEEYVRTFPAGLGPRQYGL
RPEASRDSAVVIMTCDSLIEILMDANRFAAVFSSIVSRASTHEVLSTGVAGSYNGALQVM
SMEFQVPSPLVPTRESYFVRYCKNNPDGTWAVVDVSLDSLRPSPVIKCRRRPSGCLIQEM
PNGYSKVTWVEHVEVDDRSVHNLYRPLVNSGLAFGAKRWVGTLDRQCERLASAMASNIPN
GDLGVITSIEGRKSMLKLAERMVASFCGGVTASAAHQWTTLSGSGAEDVRVMTRKSVDDP
GRPPGIVLNAATSFWLPVPPKRVFDFLRDETSRSEWDILSNGGAVQEMAHIANGRDHGNC
VSLLRVNSANSNQSNMLILQESCTDASGSYVVYAPVDVVAMNVVLNGGDPDYVALLPSGF
AILPDGPPPAGAAPSHGEGLDTGGGGSLLTVAFQILVDSVPTAKLSLGSVATVNSLIACT
VERIKAAVCAEAGNPQ*

Other information
Ka divergence:0.0959556KaKs divergence:0.0574913
GC content 1 (%):63GC content 2 (%):65GC content divergence:0.016
Length 1 (bp):2409Length 2 (bp):2391Length divergence:-0.004
MFE 1 (kcal):-1106.24MFE 2 (kcal):-1123.29MFE divergence0.008