Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118172-GRMZM2G129140
Species:maize
Duplication type:WGD
Function (paralog1):VQ motif family protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-3.1355728917172
Log2 mRNA fold difference:-1.9447091946425
Log2 TE fold difference:-1.1734369639652
Sequences
Protein sequence

MDRGIKRSVAAAGGGPPPPKVYRVEPRDFRELVQRLTGAGTPAAAAAPGPAHRRATLKPA
MAAESRRAQAAAAVPVAAGAEQFDYAASWFSAPLLSPGYGAPGFGGGHQHQGNTGSLF*

MDHGGRRRSGAGAAGGGQPPPPPPKVYRVEPRDFRELVQRLTGAGTPAAAAAATGPATLA
AHQRVPVTPAMAAAPPAPGTAEQFDYAPWFSAPLLSPASYGAPGFGAAAGYPHHGSGGPL
L*

www.000webhost.com

Other information
Ka divergence:-0.178287KaKs divergence:0.219598
GC content 1 (%):75GC content 2 (%):80GC content divergence:0.032
Length 1 (bp):357Length 2 (bp):366Length divergence:0.012
MFE 1 (kcal):-196.1MFE 2 (kcal):-221MFE divergence0.06