Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118366-GRMZM2G041809
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279402
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGCTGSRHALRGGVRGGSRSPRARSRSGGVHHTVALKSSTLGSLSLDRDRDDDGALAGAA
KTLMRRQKQQVRGSPAKAPAREPEVINVWELMDGLDDDGKDDEEGGDADADAEGRREKSA
TGSPAEFDFDPDVIAAFRKALDENPPPPPSDVPGNEGCVDKKPDGPGGEVGVKVKQRERE
IQRFPGIVRARVSAFQQRIDAKLLAKLAPPPPPDSARKVVLYLTSLRGVRKTYEDCWSTR
SVLRSYGVRVDERDLSMHSGFKDELHAALGSSPNAGRLPQAFADGRHLGGAEEVRRMHEA
GELARALEACDVVVAPPPSSGGKGVVLDACSGCGGVRFVPCEDCSGSCKVFVEEVGTFRR
CPECNENGLVRCPLCSS*

MGCTGSRHALRGGVRSPHAWGRSRSGRAHHTVALKSSTLGSLSLERDEEMMKWRDDGGAG
AAKTPQLMRRQKQVPGSPAREPEVINVWELMDGLDDRDEEGDDANAGGEKPAPGSPAFDP
DVVAAFRKALDEIPPPPAPDGPGNDEERIKKPDGPGAGGGGDEVCVRKREIQRFPGIVRA
RVSAFQQRIDAKLAKLAPPPPAVPPPPDSARKVVVYLTSLRGVRKTYEDCWSTRSVLQSY
GVRVDERDLSMHAGFKDELHAALGSSAGRLPQVFADGRHLGGAEEIRRMHEAGELSEALE
ACEMAPPPSCPGGKGVALEACSGCGGVRFVPCEECSGSCKVFVEEAGTFRRCPECNENGL
VRCPLCSL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):1134Length 2 (bp):1107Length divergence:-0.012
MFE 1 (kcal):-604MFE 2 (kcal):-599.6MFE divergence-0.004