Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118441-GRMZM2G019413
Species:maize
Duplication type:WGD
Function (paralog1):nodulin-like protein
Function (paralog2):hypothetical protein LOC100192093

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSPSSAHWLSLVGSIWLQTINGPNADFPVYSSQLKDLKHITQVQLNFLAFASDAGKLFG
WFSGVAALHLPLWLVALVGASFGLVGYGVQYLFLDSAALRYWHLFLLTSLAGNGICWINT
VCYLLCIRNFGSSRSRVAVSLAASYLGLSAKVYTSLADSIPGHQATSKAKTYLLLNAVVP
MLVTVAVAPSLRAVDLTVTGEGQAGASTDAAFLVMFAITLATGACAVVGSIGSSTSGGGL
SSREHVVSLAVLLATPVLIPLALRVRESLDRIRETKRENRIYDLGTDDDGVVVDVAATAE
SKDGDGGVTEKPQEEVDGLRLLRKLDFWLYFFSYMFSGTLGLVFLNNLGQIAESRRLGQT
STLVSLSSSFGFFGRLLPSFLDYYSAKSGYSISRTGSMASLMAPMSGAFLLLLNRSHFIL
YLSTAVIGTCTGAITSVAVSATSELFGAKNFGVNHNVVVSNIPVGSLCFGYSAAYLYQRG
ARGGGHHCVGAACYRETFVVWGATCAVGTLLCAVLYARSRREATGTGGG*

MPSPSSAHWLSLVGSIWLQTVNGPNADFPVYSSQLKELKHITQVQLNFLAFASDAGKLFG
WFSGVAALYLPLWLVAFVGAAFGLVGYGVQYLFLDSAGLRYWHLFLLTSLAGNGICWINT
VCYLLCMRNFGSSSRVAVSLATSYLGLSAKVYTSLADSVPGLVASGSKAKTYLLLNAAVP
MLVAVAVAPSLRVVQLRSEASTESDAAFLVMFAITLATGACAVVGSIGSTSGSGGLSSRE
HVISLGVLLATPVLIPLALRVRESLNKIRATKRENRIHDLGADDDAGAGAGVVVDVGGAG
PESKEGEGDGGVSEKPREEIGGLRLLRKLDFWLYFFSYMFSGTLGLVFLNNLGQIAESRR
LGQTSTLVSLSSSFGFFGRLLPSFLDYYSAKSGYSISRTGSMASLMAPMAGAFFLLLNSS
DFFLYLSTAVIGTCTGAIASVAVSATSELFGAENFGVNHNVVVSNIPVGSLCFGYLAAYL
YQRAAGGSSSHQCIGAACYRDTFAVWGATCAVGTLLCAVLYARGRRRRAAPPGEVIRTAR
ASPA*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):1590Length 2 (bp):1635Length divergence:0.014
MFE 1 (kcal):-765.45MFE 2 (kcal):-811.5MFE divergence0.029