Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118737-GRMZM2G170842
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382511
Function (paralog2):hypothetical protein LOC100191591

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.68843283880904
Log2 mRNA fold difference:-0.003365318540057
Log2 TE fold difference:-0.65007001153112
Sequences
Protein sequence

MELAVGGGMRRSASHTSLSESDDFELTRLLSKPRINVERQRSFDDRSLSDVSHSGGYGRG
GFDGMYSPGGGLRSLVGTPASSGLHSFEPHPIVGDAWEALRRSLVLFRGQPLGTVAAVDH
ASEEVLNYDQVFVRDFVPSALAFLMNGEPDIVKNFLLKTLLLQGWEKKVDRFKLGEGAMP
ASFKVMHDAKKGVETLHADFGESAIGRVAPVDSGFWWIILLRAYTKTTGDLTLAETPECQ
KGMRLILSLCLSEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQALFFMALRCALQMLKH
DNEGKEFVEKIATRLHALSYHMRSYFWLDFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIP
DWLFDFMPCQGGFFIGNVSPARMDFRWFALGNMIAILSSLATPEQSVAIMDLIEERWEEL
IGEMPLKICYPAIENHEWRIVTGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQIAR
RAIDLAERRLLKDGWPEYYDGKLGRYVGKQARKFQTWSIAGYLVAKMMLEDPSHLGMISL
EEDRAMLKPVLKRSASWTN*

MELAVGGGMRRSASHTSLSESDDFELTRLLSKPRINVERQRSFDDHSLSDVSHSGGYGRG
GFDGMYSPGGGLRSLVGTPASSALHSFEPHPIVGDAWEALRRSLVFFRGQPLGTVAAVDH
ASEEVLNYDQVFVRDFVPSALAFLMNGEPDIVKNFLLKTLLLQGWEKKVDRFKLGEGAMP
ASFKVMHDAKKGVETLHADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLAETPECQ
KGMRLILSLCLSEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQALFFMALRCALQMLKH
DNEGKEFVEKIATRLHALSYHMRSYFWLDFQQLNDIYRYKTEEYSHTAVNKFNVIPDSIP
DWLFDFMPCQGGFFVGNVSPARMDFRWFALGNMIAILSSLATPEQSNAIMDLIEERWEEL
IGEMPLKICYPAIENHEWRIVTGCDPKNTRWSYHNGGSWPVLLWLLTAACIKTGRPQIAR
RAIDLAERRLLKDGWPEYYDGKLGRYVGKQARKFQTWSITGYLVAKMLLEDPSHLGMIAL
EEDKAMLKPVLKRSASWTN*

www.000webhost.com

Other information
Ka divergence:0.203445KaKs divergence:0.298315
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):1680Length 2 (bp):1680Length divergence:0
MFE 1 (kcal):-649.74MFE 2 (kcal):-644.51MFE divergence-0.004