Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118939-GRMZM2G125308
Species:maize
Duplication type:WGD
Function (paralog1):BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1
Function (paralog2):hypothetical protein LOC100216921

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKALGRAMRWASCCKLSDGDEPGRRKKDASWRIFSLKELQSATNNFNYDNKVGEGGFGSV
YWGQLWDGSQVAVKRLKSWSNKAETEFAVEVEILARVRHKSLLSLRGYCAEGQERLIVYD
YMPNLSIHAQLHGQHAAECNLSWERRMKIAVDSAEGIAYLHHHATPHIIHRDVKASNVLL
DSNFQARVADFGFAKLVPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVFSLGVMLLE
LASGKKPVEKLNPTTKRTIAEWALPLARDRKFKEIADPKLNGSFVEDELKRMVLVGLACS
QDKPEQRPVMSEVVELLRGESTERLSRLENGDLFKPDISFHGSSGPDSSDCVTEERSPKA
DATEEAVDSSETVPSAR*

MGWASCCKRSDGAEPGRRRRKKKDTAWRIFSLKELQSATNNFNYDNKLGEGGFGSVYWGQ
LWDGSQIAVKRLKSWSNKAETEFAVEVEVLARVRHRSLLSLRGYCAEGQERLIVYDYMPN
LSIHSQLHGQHAAECNLSWERRMRIAVDSAEGIAYLHHSATPHIIHRDVKASNVLLDADF
QARVADFGFAKLVPDGATHVTTKVKGTLGYLAPEYAMLGKASESCDVFSFGVTLLELASG
RRPVEKLSPTAAAKQTVTEWALPLARARRFGEIADPKLGGGFVEEELKRVVLVGLVCAQD
RPELRPTMSEVVQLLKGESAEKLDSLENDCLFKPGGGSFQGSDCVGEGEGEGEGRSPGAD
GGIQEAVDSSETVSSAS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):65GC content divergence:0.102
Length 1 (bp):1134Length 2 (bp):1134Length divergence:0
MFE 1 (kcal):-419.34MFE 2 (kcal):-519.45MFE divergence0.107