Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118950-GRMZM2G175140
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273369
Function (paralog2):hypothetical protein LOC100272903

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.9255868725549
Log2 mRNA fold difference:3.1840141521912
Log2 TE fold difference:-1.4965919232262
Sequences
Protein sequence

MATCATDLAPLLGPAAANATGYLCSQFADTASAVDATYLLFSAYLVFAMQLGFAMLCAGS
VRAKNTMNIMLTNVLDAAAGALFYYLFGFAFAFGTPSNGFIGRHFFGLQRLPRTGFDYDF
FLYQWAFAIAAAGITSGSIAERTQFVAYLIYSAFLTGFVYPVASHWFWSADGWAAAGRTS
GPLLFGSGAIDFAGSGVVHMVGGIAGFWGALVEGPRIGRFDHAGRSVALRGHSASLVVLG
TFLLWFGWYGFNPGSFTTILKSYGPAGTVHGQWSAVGRTAVTTTLAGSVAALTTLFGKRL
QAGHWNVVDVCNGLLGGFAAITAGCSVVEPWAAVVCGFVSAWVLIGANALAARLRFDDPL
EAAQLHGGCGAWGVLFTGLFARQEYVEEIYGAGRPYGLLMGGGGKLLAAQIVQIVVIAGW
VSCTMGPLFYALKRLDLLRISADDEMSGMDLTRHGGFAYEDPGDNAGVGEFTLKSAQNRV
EPPASSNRV*

MSTCAADLAPLLGPAAANATDYLCGQFADTASAVDATYLLFSAYLVFAMQLGFAMLCAGS
VRAKNTMNIMLTNVLDAAAGALFYYLFGFAFAFGTPSNGFIGKQFFGLKHLPRTGFDYDF
FLYQWAFAIAAAGITSGSIAERTQFVAYLIYSAFLTGFVYPVVSHWFWSADGWAGASRTS
GPLLFGSGVIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFDHAGRSVALKGHSASLVVLG
TFLLWFGWYGFNPGSFTTILKSYGPAGTVHGQWSAVGRTAVTTTLAGSVAALTTLFGKRL
QTGHWNVVDVCNGLLGGFAAITAGCSVVEPWAAVICGFVSAWVLIGANALAARFRFDDPL
EAAQLHGGCGAWGVLFTGLFARRKYVEEIYGAGRPYGLFMGGGGKLLAAQIIQILVIAGW
VSCTMGPLFYALKKLGLLRISADDEMSGMDLTRHGGFAYVYHDEDPGDKAGVGGFMLKSA
QNRVEPAAAVAAATSSQV*

Other information
Ka divergence:-0.678709KaKs divergence:-0.579217
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1470Length 2 (bp):1497Length divergence:0.009
MFE 1 (kcal):-749.61MFE 2 (kcal):-765.11MFE divergence0.01