Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G118992-GRMZM2G145059
Species:maize
Duplication type:TD
Function (paralog1):LOC100285067
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0481228570887
Log2 mRNA fold difference:-2.6572784706495
Log2 TE fold difference:1.3054777716914
Sequences
Protein sequence

MGTASTSPDTMEAARLPGLSITVEKNPPEARLLQLGVKSWPKWGCPPGRFPLKFDAALTC
YLVKGRVRAAVKGSRECVEFGAGDLVVFPKGLSCTWDVVVGVDKHYNFDPS*

MRRWGCPPGRFPLKFDAALTCYLVKGRVRAAVKGSRECVEFGAGDLVVFPKGLSCTWDVV
VGVDKHYNFDPS*

Other information
Ka divergence:1KaKs divergence:0.999513
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):336Length 2 (bp):219Length divergence:-0.211
MFE 1 (kcal):-145.81MFE 2 (kcal):-96.5MFE divergence-0.203