Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119485-GRMZM2G059021
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275638
Function (paralog2):hypothetical protein LOC100217009

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASTCFRAAARVASAASRSAAAYRSAPSAARAGAGGARVLRGIVTAAAAQCGGVSQADVA
AEHGVELPCSLSARCCRHMTLIVLERYYWELAVLPHTIMKNEYFNTEIVLED*

MASTCFRAAARVASAAGRSAAATRSAPSAARAAAAAHRASSFSRMPVELGCCAGLSLLPL
HSAVAAARLTSRLSTASSCRALSQGILCCTYPGL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):74GC content divergence:0.088
Length 1 (bp):339Length 2 (bp):285Length divergence:-0.087
MFE 1 (kcal):-147.4MFE 2 (kcal):-150.2MFE divergence0.009