Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119623-GRMZM2G040452
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):catalytic/ protein phosphatase type 2C

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGICASSKRVRQEEQDSDENVVYVMDEQGGGGEGEDGRGARAAASRKVASLFSQKGKKGP
NQDAVILCQGFGMEDGVFCGVFDGHGRCGQFISKLVRDYLPFMILSHRNALLMGSDDDDD
DPAFSDASASASASSTDGSGQSSPAPAQLLEEWREACANAFEAMDKELKLQANVDCNFSG
TTAVCAIKQGKDLIVANLGDSRAVLATMSDTGYLKAVQLTTDQKPNVPQEAERIKRCNGR
VFALKDEPSVLRVWLPDEDCPGLAMARSLGDYRLKRHGVVSEPEVTHRRVAPGDLFIILA
TDGVWDVLSNEEVVSIVCATPRKQHASKAVAEAAAQRWRTRYPTSRVDDCSAVCLFLRDQ
DWASSVAAARAKAAASR*

MVQRFLCCGLSSSPGNAAVLAHALDLGLGVGGQKIPGTVLPITSTKKITAATHHQFTVRS
DKCTATTTNSPYFSEGFGMEDGVFCGVFDGHGRCGQLVSKLARDHLPFMILSQRNALLLG
SDDDGDGPAFSDASPAASSSTDGSRSERSSPAPAQMLEEWREACANAFEAMDRELGVQAK
VDCDFSGTTAVCAIKQGEDLVVANLGDSRAVLATVSETGYLKAVQLTTDQKPNVPQEAER
IKRCNGRVFALKDEASVPRVWLPDEDCPGLAMARSLGDHRLKRHGVVSEPEVAHRRVAPG
DLFLVLATDGVWDVLSNQEVVSIVCATPRKQHASKAVAQAAAQRWRTRYPASRVDDCSAA
CLFLRDQDWATSVAAAPKAKAAASR*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):68GC content divergence:-0.014
Length 1 (bp):1134Length 2 (bp):1158Length divergence:0.01
MFE 1 (kcal):-585.8MFE 2 (kcal):-566.15MFE divergence-0.017