Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119755-GRMZM2G023081
Species:maize
Duplication type:WGD
Function (paralog1):cell number regulator 7
Function (paralog2):PGPS/D12

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MYPAKPTVATASEPVTGMAAPPVTGIPISSPGPAVAASQWSSGLCACFDDCGLCCMTCWC
PCVTFGRIAEVVDRGATSCAAAGAIYTLLACFTGFQCHWIYSCTYRSKMRAQLGLPDVGC
CDCCVHFCCEPCALCQQYRELRARGLDPALGWDVNAQKAANNNAGAGMTMYPPTAQGMGR
*

MYPAKPAASSSQPAAEMAQPVVGIPISSPGAVAVGPVVGKWSSGLCACSDDCGLCCLTCW
CPCITFGRIAEIVDRGATSCGVAGTIYTLLACFTGCHWIYSCTYRSRMRAQLGLPEACCC
DCCVHFCCEPCALSQQYRELKARGFDPDLGWDVNAQKAAAAAAMYPPPAEGMMIR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):543Length 2 (bp):528Length divergence:-0.014
MFE 1 (kcal):-288.1MFE 2 (kcal):-252.3MFE divergence-0.066