Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119761-GRMZM2G180578
Species:maize
Duplication type:WGD
Function (paralog1):LOC100283005
Function (paralog2):26S proteasome non-ATPase regulatory subunit 3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.53542443642181
Log2 mRNA fold difference:-0.51121575114679
Log2 TE fold difference:-0.022683153490111
Sequences
Protein sequence

MPEDVQMNDSEPQSAAPAPAAAAAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTV
ALRRRLAARDVSAFLAFALPASSEAYGRLIALVPKEDDTEMDVDAVAPATQISIKHGLPE
IEIYCYLLALIFLIDQKKYDEAKVCASVSIARLKNLNRRTVDVLASRLYFYYSYVYELTN
SLAEIRGNLLALHRMATLHRDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSN
QQFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPTTARGFRIQCNKWAIIVRLLLGEIP
ERTVFMQKGMKKALTPYFELTNAVRVGDLELFRTVADKFASTFSADRTRNLIVRLRHNVI
RTGLRNISISYSRISLADIAKKLRLDSENPVADAESIVAKAIRDGAIDATIDHANGWMVS
KETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKESAEKRRERLQQEEEL
AKHMAEEEDDDF*

MTEDVQMNDSEPQPAASAPAVGAPALSTLHHLKEIASVIEAGSLSKEVRRISRAFRLTVA
LRRRLAARDVSAFLAFALPASSEAYGRLTALVPKEDDTEMDVDAAAPATQISIKHGLPEI
EIYCYLLVLIFLIDHKKYDEAKACASVSIARLKNLNRRTVDVLASRLYFYYSYVYELTNS
LAEIRGNLLALHRMATLHRDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQ
QFCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPITACGFRIQCNKWAIIVRLLLGEIPE
RTVFMQKGMKKALIPYFELTNAVRVGDLELFRAVADKFASTFSADRTRNLIVRLRHNVIR
TGLRNISISYSRISLADIAKKLRLDSENPIADAESIVAKAIRDGAIDATIDHANGWMVSK
ETGDVYSTNEPQIAFNSRIAFCLNMHNEAVKAMRFPPNSHKEKESAEKRRERLQQEEELA
KHMAEDDDDDF*

Other information
Ka divergence:0.0612724KaKs divergence:0.043513
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):1479Length 2 (bp):1476Length divergence:-0.001
MFE 1 (kcal):-498.72MFE 2 (kcal):-481.82MFE divergence-0.017