Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119890-GRMZM2G125345
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276302
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.14535779680418
Log2 mRNA fold difference:-0.69575778635766
Log2 TE fold difference:0.33050802850187
Sequences
Protein sequence

MDSGSDSDGAPEELTAVQGVAKHEETSKVEKDSVLRVTREGKERRKRWAQRRTSSKPDKK
APKEVEDEDTKKSEEHEETNTMPGMLPTSVIEILAAREKQTFASDSEEENVKQKVQRRKK
RMKTDGPETILLKDVRSTQHVKNALDFLEHRKNRVPRSNAVLKNASKALRLLSSKGNFLS
*

MDSGSDSDGAPEELTAVQGVEKHEEISQVEKDSAIRVTREGKERRKRWAQRRTSSKPDKK
APKEVVEDEGTKQSEETDTMPGMLPTSVIEILAAREKQTFASDSEEENVKQKVQKRKKRM
KTAGPETILLKDVRSTQHVKNALDFLEQRKKQVPRSNAVLKNASKALRLLSSKGNFLS*

Other information
Ka divergence:-0.623025KaKs divergence:-0.632638
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):543Length 2 (bp):537Length divergence:-0.006
MFE 1 (kcal):-158.05MFE 2 (kcal):-148.4MFE divergence-0.031