Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G119894-GRMZM2G085111
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100194270

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MHELGGKEQPYEGEQSREHTARRASSIAQSRGGERFVSAEARIFDAATAAMPESWRPAEA
NASSQPAAGTSGPSAQSPGNDAKGRAAGETPGAAEAAATRVPFHKLFAFADSTDVALMLL
GALGAVANGAAMPFMTVLFGNLIDAFGGALSIHDVVNRVSMVSLDFVYLAIASAVASFVQ
VTCWMITGERQAARIRNLYLKTILRQEIAFFDKYTSTGEVVGRMSGDTVLIQDAMGEKVG
KFIQLVVTFFGGFIVAFAQGWLLTLVMMATIPPLVVAGAVMSNVVTKMASLGQAAYAESS
VVVEQTIGSIRTVASFTGEKRAVEKYNKSLKSAYKSSVREGLATGLGMGTVMLLLFCGYS
LGIWSGAKLILEKGYTGAKVMNVIFAVLTGSLALGQASPSMKAFAGGQAAAYKMFETINR
APEIDAYSTTGRKLEDIRGEIEFRDVHFSYPTRPDEPIFRGFSLAIPSGTTIALVGQSGS
GKSTVISLIERFYDPQLGDVLIDGVNLKEFQLRWIRSKIGLVSQEPVLFAASIKENIAYG
KASATDQEVRAAAELANAAKFIDKMPQGFDTSVGEHGTQLSGGQKQRIAIARAILKDPRI
LLLDEATSALDAESERIVQEALDRVMSNRTTVIVAHRLSTVRNADTIAVIHQGTLVEKGP
HNELLRDPEGAYSQLIKLQEANQQNNRKGDGNARLGKQMSMNKSASRRLSRDNSSHHSFS
VPFGMPLGIEIQDGSSNKLCDEMPQEVPLSRLASLNKPEIPVLVLGSIASVISGVIFPIF
AILLSNVIKAFYEPPHLLRRDSQFWASMFLVFGAVYFLSLPVSSYLFSIAGCRLIRRIRL
MTFEKVVNMEVEWFDHPENSSGAIGARLSADAAKVRGLVGDALQLVVQNSSTLVAGLVIA
FVSNWELSLIILALIPLIGLNGWIQMKFIQGFSADSKMMYEEASQVANDAVSSIRTVASF
SAEEKVMDLYKKKCEGPLRTGIRTGIISGIGFGVSFFLLFGVYAASFYAGARLVEDRKTT
FPKVFRVFLALAMAAIGVSQSSTLTSDSSKAKSAASSIFAIVDRKSRIDPSEDAGVTAET
LRGNIEFQHVSFRYPTRPDVQIFRDLCLTIHAGKTVALVGESGSGKSTAISLLQRFYDPD
VGHILLDGVDIRKFQLRWLRQQMGLVSQEPALFNDTIRANIAYGKDGQATESEIVSAAQL
ANAHKFISSALQGYDTMVGERGAQLSGGQKQRVAIARAIVKDPRILLLDEATSALDAESE
RIVQDALDRVMVNRTTVVVAHRLSTIQNADLIAVVRNGVIIEKGKHDALVNVKDGAYASL
VALHSAASS*

MPESWRPAEADALQPAAGTASASGPSARSPGNGAKGRGAGEPPGAAATRVPFHRLFAFAD
SADVALMLLGALGAVANGAALPFMTVLFGNLIDAFGGALSVHDVVSRVSMVSLDFVYLAM
ASAVASFVQVTCWMITGERQAARIRNLYLKTILRQEIAFFDKYTSTGEVVGRMSGDTVLI
QDAMGEKVGKFVQLLVTFFGGFIVAFAQGWLLTLVMMATIPPLVLAGAVMSNVVTKMASL
GQAAYAESSVVVEQTIGSIRTVASFTGEKRAVDKYNMSLKNAYKSGVREGLATGLGMGTV
MVLLFCGYSLGIWYGAKLILEKGYTGAKVMNVIFAVLTGSLALGQASPSMKAFAGGQAAA
HKMFETINRTPEIDAYSTTGRKLEDVRGDIEFRDVYFSYPTRPNEQIFKGFSLAIPSGTT
IALVGQSGSGKSTVISLIERFYDPQLGDVLIDGVNLKEFQLRWIRSKIGLVSQEPVLFAA
SIKENIAYGKDNATDQEIRAAAELANAAKFIDKMPQGFDTSVGEHGTQLSGGQKQRIAIA
RAILKDPRILLLDEATSALDAESERIVQEALDRVMTNRTTVIVAHRLSTVRNADTIAVIH
QGTLVEKGPHSELLRDPEGAYSQLIRLQEANQQNNGKVDANARPGKQISINKSASRRSSR
DNSSHHSFSVPFGMPHGIDIQDGSSNKLCDEMPQEVPLSRLASLNKAEIPVLILGSIASV
ISGVIFPIFAILLSNVIKAFYEPPHLLRRDSQFWASMFLVFGAVYFLSLPVSSYLFSIAG
CRLIRRIRLMTFEKVVNMEVEWFDHPENSSGAIGARLSADAAKVRGLVGDALQLVVQNSS
TLVAGLVIAFVSNWELSLIILALIPLIGLNGWIQMKFIHGFSADAKMMYEEASQVANDAV
GSIRTVASFSAEEKVMDLYKKKCEGPLRTGIRTGIISGIGFGVSFFLLFGVYAASFYAGA
RLVEDRKTTFPKVFRVFLALAMAAIGVSQSSTLTSDSSKAKSAASSIFAIVDRKSRIDPS
EDAGVTVEALQGNIVFQHVSFKYPTRPDVQIFRDLCLTIHAGKTVALVGESGSGKSTAIS
LLQRFYDPDVGHILLDGVDIQKFQLRWLRQQMGLVSQEPALFNDTIRANIAYGKDGQATE
SEIISAAELANAHKFISSALQGYDTVVGERGAQLSGGQKQRVAIARAIVKDPRILLLDEA
TSALDAESERIVQDALDRVMVNRTTVIVAHRLSTIQNADLIAVVRNGVIIEKGKHDALIN
IKDGAYASLVALHSAASS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):53GC content divergence:-0.028
Length 1 (bp):3990Length 2 (bp):3837Length divergence:-0.02
MFE 1 (kcal):-1583.01MFE 2 (kcal):-1452.18MFE divergence-0.043