Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120069-GRMZM2G337548
Species:maize
Duplication type:WGD
Function (paralog1):LOL3
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.3591440366617
Log2 mRNA fold difference:-2.1564573115015
Log2 TE fold difference:0.98222411865182
Sequences
Protein sequence

MASARPPQAQRTAWCGRCGARLSVAPGARSVRCALCHAVTRVERRPHGLHRAAVGFIRGL
IGGLTPPQRPAAALQELPPSSFPRVRGCKKRALLVGISYAGTRYELGGAVNDVNCMSYLL
RERFGFPAECILVLTQEDMEPGRVPTRANLMRALRWLVDGASAGDSLVFHFSGHGVQKLD
RDGDEADGYDEALCPVDFEDPRGGGGVILDDEINATIVRPLGKGVKLHAIVDTCHSGTIL
DLPYLCRLSRTGYWQWENQQTARLAASGETKCTSGGLAISISGCGDSQTSQDTTALSGSA
STGAMTYSFIKAVESEPGTTYGRLLTAMRATIRDNGGEFGIPGPIGTFFRRVITFSCAQE
PQLCASETFDIYRKPFLL*

MASARPPQAQGTTTCCTGCGACLRVAPGARSVRCGLCHAVTRGERRPPHGLHHAAVGIIK
GLTGVFASPRGTGGGGGAGAVLQELPASFPRVRGCKKRALLVGISYAATKHELRGAVNDV
HCMSYLLRERFGFPEECILVLTQEDKDPARVPARANLMRALRWLVDGTSAGDSLVFHFSG
HGVQRLDRDGDEADGYDEALCPVDFDDPHGGGVILDDEINATIVRPLGKGVKLHAFVDTC
HSGTMLDLPYLCRLSRTGYWQWENQQSGLSGDTKCTSGGLAISISGCADSQMSQDSTSVS
APTSTGAMTYSFIKAVESEPGTTYGRLLAAMRATIRQNGGELGIPGPIGTFFRRVITFSC
AQEPQLCASETFDVYTKPFLL*

Other information
Ka divergence:0.332702KaKs divergence:0.0945243
GC content 1 (%):71GC content 2 (%):70GC content divergence:-0.007
Length 1 (bp):1137Length 2 (bp):1146Length divergence:0.004
MFE 1 (kcal):-583.42MFE 2 (kcal):-586MFE divergence0.002