Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120296-GRMZM2G078267
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MISSPSPSPSSSRTSKGGSATPPSRASKWRSGAVRGVYGRRLLDALRATGGGQPRAVKAA
ADSALALTARGQTRWSRAILLAGAVCSRRRVLVKAGGKVRRRRRPPPPVQARDKAAAAAA
LKGKEGKVQERLRVLGRLVPGCRKLPTPALLEEAADYVAALQMQVSAMRALADALAAAQL
SSPADAEAEAEAER*

MISSPSPSPSPSPSGTPSPKGVSATPRQGSSRWRSGAVRGAYGRRLLDALRATGGGQPRP
RAVKAAADSALALTARGQTRWSRAILLAGAACGRRRRVLVKAGGKVRRRRRRPPVQARDK
AAVAALKGQGKDKVQERLRALGCLVPGCRRLPAPALLEEAADYVAALQMQVSAMRALADA
LAAAQLSSPAER*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):77GC content 2 (%):79GC content divergence:0.013
Length 1 (bp):585Length 2 (bp):579Length divergence:-0.005
MFE 1 (kcal):-369.3MFE 2 (kcal):-379.71MFE divergence0.014