Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120674-GRMZM2G007260
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192052
Function (paralog2):hypothetical protein LOC100193988

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSTPARKRLMRDFKRLQQDPPAGISGAPYDNNIMLWNAVIFGPDDTPWDGGTFKLTLQCT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNS
PANSEAARMFSENKREYNRKVREVVEQSWTAD*

MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT
EDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQFWNKYSSSIR
TVEERNGFPRLPDVTRESPCCVTQTQILLPTLKQPECSARTSVSTTAKFVRLWSRAGQLI
KTLELDSRLKLYWLHQMVQISIHLS*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):50GC content divergence:-0.029
Length 1 (bp):459Length 2 (bp):618Length divergence:0.148
MFE 1 (kcal):-155.21MFE 2 (kcal):-197.62MFE divergence0.12