Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120724-GRMZM2G356273
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100193290
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.9525706074965
Log2 mRNA fold difference:-0.15488832133752
Log2 TE fold difference:-1.8241972673377
Sequences
Protein sequence

MAPRLLLFLLLLLPLLAAGHQHPSSYGSSALSEWRPAKASYYAADPEDAIGGACGFGDLG
KHGYGMATVGLSTALFERGAACGGCYEVKCVEDLKYCLPGTSIVVTATNFCAPNYGLPAD
AGGHCNPPNHHFLLPIQSFEKIALWKAGIMPIQYRRVKCLREGGVRFSVNGRHFFFTVLI
SNVGGAGDVRSVKIKGTELGWLPMGRNWGQVWHINCDMRGQPLSFELSSSDGKALTSFNV
VPKDWEYGKTYTGKQFLL*

MNLLICGVQYLHKYSTNVQTSLCESKLTLCNESVKCLREGGVRFSVNGRHFFFTVLISNV
GGAGDVRSVKIKGTELGWLPMGRNWGQVWHINCDMRGQPLSFELSSSDGKALTSFNVVPK
DWEYGKTYTGKQFLL*

Other information
Ka divergence:1KaKs divergence:-0.764687
GC content 1 (%):61GC content 2 (%):47GC content divergence:-0.13
Length 1 (bp):777Length 2 (bp):408Length divergence:-0.311
MFE 1 (kcal):-314.2MFE 2 (kcal):-137.5MFE divergence-0.391