Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120922-GRMZM2G368398
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):transposon protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.5480990430997
Log2 mRNA fold difference:2.5820796494141
Log2 TE fold difference:-1.0617375892084
Sequences
Protein sequence

MAPHTTGVGGGSGAEEEVSEAAAASPALRHRHAGKGEAEAEGLDGNGDAGADGQASLERV
FADKAVPSWREQLTLRAFVVSALLAVMFNVIVMKLNLTTGIVPSLNVSAGLLGFFFVRMW
TAAVERMGFLCHPFTRQENTIIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEAKDAN
NIKDPHLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAK
LAKKQVKTLGKYFMFSFFWGFFQWFYTAGDECGFKNFPTLGLEAYNNRFFFDFSPTYVGV
GMICPYIVNVSVLLGGILSWGVMWPLIAKKKGSWYLASVDDSSLHGLQAYMVFISIALIL
GDGLYNFIKVLIRTIAGFISMVQQNSKGMLPVSDNGSSMSATEALSFDDERRTEIFLRDQ
VPKSVAYGGYVVVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSGLTDWSLAS
TYGKLAIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFV
SQVIGTGMGCVIGPCVFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDGFGSLPENC
LTLCYIFFAAAIAINLARDLTPHRVSRFIPLPMAMAIPFYIGSYFAIDMFLGSMILFVWE
RLNKAKADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLSRSTNAKVDSFLGL
S*

MAPHTTAGGGGGAEDEVSEAAAASPALRHRHAGKGEGLGGNGGAGADGQASVERVFADKA
VPSWREQLTLRAFVVSALLAVMFSVIVMKLNLTTGIIPSLNVSAGLLGFFFVRMWTAAAE
RMGFLRQPFTRQENTVIQTCVVSAYGIAFSGGFGSYLFGMSDKIAKQATEAKDANNIKDP
HLGWMIGFLFLVSFIGLFALVPLRKIMIVDYKLTYPSGTATAYLINGFHTPEGAKLAKKQ
VKTLGKYFVFSFFWGFFQWFYTAGDECGFKNFPTLGLEAYNNRFFFDFSPTYVGVGMICP
YIVNVSVLLGGILSWGLMWPLIAKKKGSWYPANLEDSSLHGLQAYRVFISIALILGDGLY
NFIKVLIRTIAGFISMVQQNSKSMLPVSDNGSSMSSMEAVSFDDERRIENFLKDQIPKSV
AYGGYVAVAAISIGTLPQIFPQLKWYYILVAYVVAPVLAFCNAYGSGLTDWSLASTYGKL
AIFVFGAWAGLSHGGVLVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFISQVIG
TGMGCVIGPCIFWLFYKAFGDIGESGTEYPAPYAIVYRNMAILGVDGFGSLPKNCLTLCY
IFFAAAITINLVRDLTPYKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSAILFVWERLNKA
KADAFGPAVASGLICGDGIWTLPQSILALAKVQPPICMKFLSRSTNAKVDSFLGLS*

Other information
Ka divergence:-0.428766KaKs divergence:-0.410275
GC content 1 (%):56GC content 2 (%):54GC content divergence:-0.018
Length 1 (bp):2166Length 2 (bp):2151Length divergence:-0.003
MFE 1 (kcal):-889.5MFE 2 (kcal):-852.1MFE divergence-0.021