Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G120971-GRMZM2G323828
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384760
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.6335588506725
Log2 mRNA fold difference:-0.18327589985005
Log2 TE fold difference:1.884374420569
Sequences
Protein sequence

MAPPSRDYWLGFFRGAGDNVFDAIDAAITVAASDHPAALRERRDGIAERLFTALLVTGAA
GAGAAAGQGGSAGRTPVPSLCSSDRAEAVTDDGAPRGDDPVLAETERIKAVLLGGHDKSE
SELLELLRRLQELDLAFDTLDVTAIGKAVSNFRKHSSKQIRTLVRSLIEGWKRTVDMWIA
RRREAVVDQTPQSMGPSSLEDQEDRGAAFTHMDEGDLFATPSTTIRLSEENPGSKFSDAT
EGDGGMVNNTSRDCGERYPSNQGGPARRPPPMGQQRYDPGPCWRQEPSSGQTKEQFVAEM
LARPSSAAGSGPGRPQQARPRQQRQEDASSPAQGSRPQSVGCF*

MAPPSRDYWLGFFRGAGDNIFDAIEAAITVAASDHPAALRERRDGIAERLFTALLVTSAA
AAAAGAAAAAPGGGAAGGTPVAGAPTPAQLHPEGAASVPSLCSSDRAEAIADDAAPRCDD
PVLAETERIKAVLLSDQEKPEAELLELLRRLQELDLAFDTLDATAIGKAVANFRKHSSKQ
IRNLVRSLIEDWKHTVDVWIAHRRDAVVDQTPQSMGPSSLEQEDRGAASTHMDEGDLFAT
PSTTIRLSEENMDGDGSIMTNDSRDCGQRYPMMNQEPARRPPPMGQRYDPEPCWRQSRPQ
ELSNGQTKEQFVAEMLARPSSVESGPGRPQARPRQQHQDTPAAQARPQPAASEKPAAQLD
ANSVRAKLELAKNAKLEATKRKLQEGYQESDN

Other information
Ka divergence:-0.241435KaKs divergence:0.291643
GC content 1 (%):68GC content 2 (%):66GC content divergence:-0.015
Length 1 (bp):1032Length 2 (bp):1176Length divergence:0.065
MFE 1 (kcal):-507.6MFE 2 (kcal):-541.2MFE divergence0.032