Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G121625-GRMZM2G042143
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVFKEKQKEFYKNAKLISKYKKTKKQQSQSNNHPEIPVHEDGGDTVRYVAKPHHKGKKHP
VHSLKEEYEKKRAEEEKAKEERDAMVQAKREHREKSEAKRKELREKMFKKTRSGQPVMRY
RIEHLLETALSK*

MKRQPPHPRGGGGAAVGESGSGGGFHKGEGKGKGRWGGGCRRRNEQRLGVGGGGGALSLA
AFASAKSRTTGYNPAVIKKQKEFYKNAKLISKYKRTKKQQSQSNDHPQIPIHEDGGDNAQ
YVPKPRYQGKKRTAHSLKEEYEKKRAEDEKAKKEQDAAVQAKREHREKSEAKRRELREKM
FKKTRSGQPVMRYRIEHLLETALSK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):58GC content divergence:0.126
Length 1 (bp):399Length 2 (bp):618Length divergence:0.215
MFE 1 (kcal):-100.84MFE 2 (kcal):-209.78MFE divergence0.351