Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G121683-GRMZM2G155709
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382048
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.016328510213653
Log2 mRNA fold difference:-0.53810622471903
Log2 TE fold difference:0.52834805952918
Sequences
Protein sequence

MAMDDLAGASSSSSMAAAASSDPSHGWQTVSYPKRNRKQAQPPRTTAPDLALQSNGKPGG
VFDAVEKRSQERHRALQQQLASRAADLDDARIAVATGAAYSDDDDSDEAAAPRQEGEVKK
PKKPKVKKPKVTVAEAAVLIDAENLAAHLFEISASYENQQDIQLMRFADYFGRAFAAVSA
SQFPWAKMFKESTVSKMVDIPLCHISEAVIKTVSDWISQRSSDALGDFVLWCIDSIMSEL
SGPSAGPKGSKKVAQQSPRAQVAIFVVLAMTLRRKPDVLVNVMPKIMGNNKYLGQEKLPI
IVWVIAQASQGDLVSGMFCWAHSLFPTLCAKSSGNPLARDLVLQLLERILSVTKARSILL
NGAVRKGERLVPPVSFDLFMRATFPVSNARVKATERFEAAYPIIKELALAGPPGSKTVKQ
ASQQLLPLCAKAMQENNAELTREAVDVFIWCLTQNAESYKQWERIYLENIEASVAVLSKV
VIDWRDVSPKLSSEALKATVKNFKAKNEAALESTTDAGKQASIKEADKHCKAIFGKLTRG
ATCLKSSLVVIALAVAASYVLSPGMDLEKVQAMVSSHLSF*

MAMEDVAGASSSSVAAAASDPTHGWQTVSYPKRHRKQAHQPPRAMAPDLALQANGKGSGV
FDAVEKRSQERHRALQQQLASRAADLDDARIAPVTGGAYSDDSDSDEATAPRQVGEVKKP
KKPKKPKVTVAEAAALIDAENLAAHLVEISSSYENQQDIQLMRFADYFGRAFVAVSASQF
AWAKMFKESTVSKMVDIPLCHIPEAVIKTASDWISQRSYDALGDFVLWCIDSIMSELSGP
SAGPKGSKKVAQQSPRAQVAIFVVLAMTLRRKPDVLVNVMPKIMGNNKYLGQEKLPIIVW
FIAQASQGDLVTGMFCWAHFLFPTLCAKPSGNPLARDLVLQLLERILSVTKARSILLNGA
VRKGERLVPPVSFDLFMRATFPVSGARVKATERFEVAYRTIKELALAGSPGSKTVKQASQ
QLLPLCAKAMQENNAELTREAVDVFIWCLTQNAESYKQWERIYPENTEASVAVLSKIVID
WKDVSPKLSSEALKATVKNLKAKNEAALESATDAGKQASIKKQTSTARLEQGSEQLLGGR
PGPALGVLATVAECSVEPAAQTTKGPDSNGSSSPLPPVLPSVCFPPRPRAMAPCASPSAL
ALSASTRVSSFPLTLRPRPRPEARVPRAPGGAQLRPATACSWPRPLLPELAPAFPRAGAR
SAGRPQPLFRPRAMMTTSQIASCAFTVGTVAVLPFYTLMVVAPNADITKRTVESSAPYVA
LGLLYAYLLYLSWTPDTLRAMFASKYWLPEVLLQHHLLKQLRAL*

Other information
Ka divergence:0.523917KaKs divergence:0.495652
GC content 1 (%):52GC content 2 (%):57GC content divergence:0.046
Length 1 (bp):1743Length 2 (bp):2295Length divergence:0.137
MFE 1 (kcal):-654.6MFE 2 (kcal):-901.56MFE divergence0.159