Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G121753-GRMZM2G049378
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):SANT/MYB protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSESRSSFRNVNTDCNWSKKENKLFEEALARYREGTPDRWLKVSRAMGGIKTADEVRRHY
EILNEDVTLIVSGGIPFPNYNTQGAWN*

MSGSRSSSSHNVTIDSEWSKKENKLFEEALACYGAGTPDRWHKVARAMGGIKTADEVRRH
HEILNEDVTLIESGRVPFPNYNTQGAWN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):57GC content divergence:0.036
Length 1 (bp):264Length 2 (bp):267Length divergence:0.006
MFE 1 (kcal):-84.44MFE 2 (kcal):-94.8MFE divergence0.058