Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G121871-GRMZM2G090869
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):pre-mRNA-processing ATP-dependent RNA helicase prp-5

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSKRPKLEGFSIPRPTSYNFERSQSVQRLYRPTDDPDLDDIAFSDDAPSDAQASTAVEGK
AENEEEMDPLDAFMAEIQEEIRAPPPPPKPEALRRTDSDDDEDDPVESFLRAKKDAGLTL
AADVMRAGYDSDEEVYAAAKAVDAGMMEYDSDDNPIVIDKKKIEPIPALDHSTIEYDAFT
KDFYEEKPSISGMSDQEVTDYMKSLSIRVSGFDVPRPIKNFEDCGFHVPLMNAIAKQAYE
KPTTIQCQALPIVLSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELEKEEGPIGVICAP
TRELAHQIYLEAKKFAKPYNLRVAAIYGGVSKFDQFKELKAGCEIVIATPGRLIDLLKMK
ALKMFRATYLVLDEADRMFDLGFEPQIRSIVGQIRPDRQTLLFSATMPYKVERLAREILT
DPIRVTVGQVGGANEDIKQVVNVLPSDVEKMPWLLGKLPGMIDDGDVLVFASKKARVDEI
EKELNQRGFRIAALHGDKDQASRMETLQKFKSGTFHVLVATDVAARGLDIKSIKTVVNFD
IAKEMDMHIHRIGRTGRAGDKDGTAYTLITQKEAHFAGELVHSLIAAGQDVPNELMDLAM
KDGRFRAKRDSRKGGKKGGKGKGGVGGAGRGRGVRGVDFGLGIGYNAESGSQVPAARSAA
VNSLKTGMLQRFKSSFVSGSSNTPSSSAPSFVRPALRGFVSGGTIGGDTRPAQAAPTFIP
ASRPAQPAPAVPASQPAGNNNENGNPNPESSRDQFRERKRPSGWDR*

MSKRPKLEGFSIPRPTSYNFERSQPVQRLYRPTDDPDLDDIAFSDDAPSDAPAGTAVDGK
AEHDEEIDPLDAFMAEIQEEIRAPPPPPKAEALRRADSGDDEDDPVESFLRAKKDAGLTL
AADAMRAGYDSDEEVYAAAKAVDAGMMEYDSDDNPIVVDKKTIEPIPALDHSTIEYDTFT
KDFYEEKPSISGMSDQEVADYMKSLAIRVSGFDVPRPIKNFEDCGFPVPLMNAIAKQAYQ
KPTTIQCQALPIVLSGRDIIGIAKTGSGKTAAFVLPMIVHIMDQPELEKEEGPIGVICAP
TRELAHQIYLEAKKFAKPYNLRVAAVYGGVSKFDQFKELKAGCEVVIATPGRLIDLLKMK
ALKMFRATYLVLDEADRMFDLGFEPQIRSIVGQIRPGRQTLLFSATMPYKVERLAREILT
DPIRVTVGQVGGANEDIKQVVNVIPSDAEKMPWLLEKLPGMIDDGDVLVFASKKARVDEI
ERELNQRGFRIAALHGDKDQASRMETLQKFKSGTYHVLVATDVAARGLDIKSIKTVVNFD
IAKEMDMHIHRIGRTGRAGDKDGTAYTLITQKEARFAGELVQSLIAAGQDVPNELMDLAM
KDVRFRAKRDSRKGGKKGGKGKGGVGGGAGRGRGVRGVDFGLGIGYNAESGSQVPAPRSA
AINSLKTGVMQQFKSSFVSGSSNTPSSSAPSLVRPALRGFVSGGTIGGDTRPAQPAPTFV
TASWPAQAAPSVPASRPAAGNNNENGNPNPKSSRDRPRERKRPSGWDR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):2301Length 2 (bp):2307Length divergence:0.001
MFE 1 (kcal):-748.2MFE 2 (kcal):-780.59MFE divergence0.021