Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G121878-GRMZM2G348512
Species:maize
Duplication type:TD
Function (paralog1):carbonic anhydrase
Function (paralog2):hypothetical protein LOC100274597

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.8708112584306
Log2 mRNA fold difference:-2.1845404198999
Log2 TE fold difference:-0.6928304224557
Sequences
Protein sequence

MYTLPVRATTSSIVASLATPAPSSSSGSGSGRPRPRLIRNAPVFAAPATVVGMDPTVERL
KSGFQKFKTEVYDKKPELFEPLKSGQSPRYMVFACSDSRVCPSVTLGLQPGEAFTVRNIA
SMVPPYDKIKYAGTGSAIEYAVCALKVQVIVVIGHSCCGGIRALLSLKDGAPDNFHFVED
WVRIGSPAKNKVKKEHASVPFDDQCSILEKEAVNVSLQNLKSYPFVKEGLAGGTLKLVGA
HYDFVKGQFVTWEPPQDAIERLTSGFQQFKVNVYDKKPELFGPLKSGQAPKYMVFACSDS
RVCPSVTLGLQPGEAFTVRNIAAMVPGYDKTKYTGIGSAIEYAVCALKVEVLVVIGHSCC
GGIRALLSLQDGAPDTFHFVEDWVKIGFIAKMKVKKEHASVPFDDQCSILEKEAVNVSLE
NLKTYPFVKEGLANGTLKLIGAHYDFVSGEFLTWKK*

MDDPVERLKDGFHKFKTEVYDKKPELFEPLKAGQAPKYVVFACSDSRVCPSVTLGLQPGE
AFTVRNIAAMVPAYDKTKYTGIGSAIEYAVCALKVEVLVVIGHSCCGGIRALLSLQDGAP
DNFHFVENWVKIGFPAKIKVKKDHASVPFDDQCSILEKEAVNLSLENLKTYPFVKEGLAN
GTLKLVGGHYNFVSGEFLTWDNKQPS*

Other information
Ka divergence:-0.262543KaKs divergence:0.0320891
GC content 1 (%):62GC content 2 (%):61GC content divergence:-0.008
Length 1 (bp):1371Length 2 (bp):621Length divergence:-0.377
MFE 1 (kcal):-561.11MFE 2 (kcal):-238.4MFE divergence-0.404