Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122028-GRMZM2G176182
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276388 (LOC100276388), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.8439493325645
Log2 mRNA fold difference:0.9425913423246
Log2 TE fold difference:1.0617013550097
Sequences
Protein sequence

MRDMPVVRRQEPTVVRTEDDVVSGGEDSDGEFEFPSVSRESAAGVGGAASADELFAGGHA
RAFYPVFGRVLDEAAAPAPRAPLGRLFQLEQARTSSVASTSSSSSSSSASTAAGTGADLD
GVGASPDSYCVWTPGSSPASSPSRPPRKSGSTGSIARWRRIGELVVGRSRSDGKDKFLFL
SAPPSPARDREHAPASKAKAKLPPKGSKAAATELDTVSAGRRLSYGGGGAKASTGGRRTF
LPYRQDLVGLFASVHGLSRSPHPL*

MREMEHKRPVVRRQEPTVARTEDDVASGDEESDVEFEFPFVSQESGAGAGAAAADELFAD
GRIRASYPVFGRVLDEAAAPAPRAPLGRLFQLERARTSSVASRSSSSSSSSSTAADADAG
VDGASPDSYCLWTPGSSPASSPSRPPRKSGSTGSVARWRRIGELVVGRSHSDGKERFLFL
SAPPSPARDRDHSTDSKAKQPSRASKSAAAELDTVPAGRRMSYGGGGGAKASTGGRRTFL
PYRQDLVGLFASAHGLSRSTLPF*

Other information
Ka divergence:0.0392065KaKs divergence:0.798012
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):795Length 2 (bp):792Length divergence:-0.002
MFE 1 (kcal):-446.61MFE 2 (kcal):-442.1MFE divergence-0.005