Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122072-GRMZM2G381025
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100274555
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2497261843351
Log2 mRNA fold difference:0.43031530744556
Log2 TE fold difference:-2.6575655487923
Sequences
Protein sequence

MDDVVPATAKQTVVLYPGGGAGHVAPMTQLAKVFVRHGYDVTMVLLEPPIKSNASGASFV
ESFAASNPSITFHLLPPIPPPDLASSTKHPFLVVLELLGQYNDKLESFLRTIPRERLHSL
VIDMFCTDAIDVAAKVGVPVYTFFAANAGALAVLTQTVALLDGRQTGLKELGDTPIEFLG
VPPIPASHIIREMLEDAEDEVRTAMAKIWKRDTDTRGVLINTFYSLEAQALQAFSDPLCV
PGKVLPPVYPIGPLVGKGGSGTDGGEAAERPHECLAWLDAQPERSVVFLCWGSRGLLSEE
QLKEIAAGLEKSGQRFLWVVRTPASSDDPKRFWLPRPEPDLDALLPEGFLERTKDRGLVI
KSWAPQVDVLSNPAVGAFVTHCGWNSSLEAITAGVPMLCWPQGAEQKINKVLMTEAMGIG
LELEGYNTGFIKAEEIETKVRLVLESEEGREIRTRAAEVKKEAHAALEDGGSSKAAFLQF
LSDVKNIN*

MLFINANGQTELPGACHRSRKSQGQSRFPNPNQSCATARCARASEMDDVSVKQIAVLYPV
GGVGHVGPMTQLAKVFLHHGYDVTMVLIEPPIKSTDSGAGFIERVAASNPSITFHVLPPT
PAPDVASSTKHPFLLILELMRQYNDKLESFLRSIPRERLHSLVIDLFCTHAIDVATRLGV
PVFKFFASGAGTLAIFTQLPALLAGRLTGLKELGDKPLQFLGVPPMPASHLATSLLESPE
DELCRTSMEILERNAGTHGVLVNTFESLEQRALQALRDPLCVPGQALPPVYPIGPLVGTG
TGRQEGDGGPQHECLAWLDAQPERSVAFLCWGSKGALPKEQLKETAVGLERCGQRFLWVV
RTPAGRDGPGRYWEQRAEADLDALLPEGFVERTKDRGLVVTSWAPQVDVLNHPATGVFVT
HCGWNSTLEAIAAGVPMLCWPLAGAEQRMNKVFITEDMGVGMEMEGYMTGLIKAEEIEGK
LRLALESEEGTRLKKRALQLKKETEEAMEDGGSSEAAFLRFLSDVANIHNQIG

Other information
Ka divergence:0.148242KaKs divergence:0.0922385
GC content 1 (%):64GC content 2 (%):63GC content divergence:-0.008
Length 1 (bp):1467Length 2 (bp):1599Length divergence:0.043
MFE 1 (kcal):-673.02MFE 2 (kcal):-720.1MFE divergence0.034