Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122223-GRMZM5G843389
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281993
Function (paralog2):protein binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.50781086248304
Log2 mRNA fold difference:-1.4254906750359
Log2 TE fold difference:1.7630445708953
Sequences
Protein sequence

MSSLSPEQRPCLSRRVTVQEQISSSFMDSPPPPHLDAPLFGADLIPSGRLRRMRGWRHSP
GGLEEEIRMFQTRVLLGGMNMYDRYQDWRLDVDNMTYEELLELGDKIGYVNTGLRDDEIT
RNLRKVKHPSFSSLRFATEMERKCSICQEEFETNEEMGRLDCGHSYHVYCIKQWLSQKNI
CPVCKTAVSKN*

MSRRATVQEQISSPFMDSPPPHLDAPFFGADLIPSGRLRRMRGYRYSPGGLEEEIMMFQT
RVLLGGMNMYDRYQDWRLDVDNMTYEELVELGDRIGYVNTGLREDEIARSLRKAKHPSFG
SLRFAAEVERKCTICQEEFQSNEEMGRLVCGHSYHVLCIKQWLSQKNTCPVCKTAVSKN*

Other information
Ka divergence:0.246475KaKs divergence:-0.0185785
GC content 1 (%):53GC content 2 (%):54GC content divergence:0.009
Length 1 (bp):576Length 2 (bp):540Length divergence:-0.032
MFE 1 (kcal):-189.47MFE 2 (kcal):-191.3MFE divergence0.005