Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122231-GRMZM2G312521
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281927
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.39311941961536
Log2 mRNA fold difference:-0.83398064886838
Log2 TE fold difference:0.47419884276189
Sequences
Protein sequence

MPSISCHNLLDLAAADDVPLPSPTPLRLPRVMSVASPASPTSPPAPAPPRRVIVSHRLPL
RASPDPAAPFGFAFSVDAGTVAYQLRSGLPANAPVLHIGTLPAAAAEAASDELSDYLLAN
FSCLPVYLPTDLHHRFYHGFCKHYLWPLLHYLLPLTPSSLGGLPFQRTLYHSFLSANRAF
ADRLTEVLCPDEDLVWIHDYHLLALPTFLRKRFPRAKVGFFLHSPFPSSEIFRTIPVRDD
LVRALLNADLVGFHTFDYARHFLTACSRLLGLDYQSKRGYIGIEYYGRTVTVKILPVGID
MGQLRSVVSAPETEDAVRRVTEAYKGRRLMVGVDDVDLFKGIGLKFLAMEQLLVEHRELR
GHAVLVQIANPARSEGRDVQGVQDEARAISARVNARFGTPGYTPIVLIDAPVTPQEKAAY
YAAAECCVVSAVRDGLNRIPYIYTVCRQESTALGDDSPKRSVIVLSEFVGCSPSLSGAIR
VNPWSVESVAEAMNAALRMPEAEQRLRHEKHYKYVSTHDVAYWARSFDSDLQRACKDHFS
RRHWGIGFGMSFKVVALGPNFRRLSVEHIVPSYRRTDNRLILLDYDGTVMPENSIDRTPS
SEVISVLNRLCEDPKNRVFIVSGRGKDELSRWFAPCEKLGIAAEHGYLTRWSRDAPWDTS
GLAADFDWKKTAEPVMQLYTEATDGSYIEHKESAIVWHHHEADPDFGSCQAKELLDHLEN
VLANEPVVVKRGQHIVEVNPQGISKGVVVDSLLSSMVRTGKPPDFVLCIGDDRSDEDMFE
SIVCPASNSGVKLPASSEVFACTVGKKPSMARYYLDDTVDVVKMLDGLASAPSQQRSRPA
VQLRVSFEGSL*

MPSFPRANVVDKTRGPSPCAHAVTPPTLTSGSPRPCPFLLPRRSDTHTHIQLAIFVPPVL
LPCPRPTSAFLSPETSAKVIDPSPTPTPTDRPPNEPDTPRRVAALLFSSCAIAAVSTSAT
PTDRQEEDEEAMPSLSCHNLLDLAAADEVPLPSPTPLRLPRVMSVASPASPTSPSPPAPP
RRVIVSHRLPLRASPDPSAPFGFRFSVDAGTVAYQLRSGLPTNAPVLHIGTLPASAAEAA
SDELSNYLLANFSCLPVYLPTDLHHRFYHGFCKHYLWPLLHYLLPLTPSSLGGLPFQRTL
YHSFLSANRAFADRLTEVLSPDEDLVWIHDYHLLALPTFLRKRFPRAKVGFFLHSPFPSS
EIFRTIPVRDDLVRALLNADLVGFHTFDYARHFLSACSRLLGLDYQSKRGYIGIEYYGRT
VTVKILPVGIDMGQLRSVVSAPETEDAVRRVTEAYKGRRLMVGVDDVDLFKGIGLKFLAM
EQLLVEHRELRGRAVLVQIANPARSEGRDVQGVQDEARAISARVNARFGTPGYTPIVLID
GPVTPQEKAAYYAAAECCVLSAVRDGLNRIPYIYTVCRQESTALGDDAPKRSAIVLSEFV
GCSPSLSGAIRVNPWSVESVAEAMNAALRMPEAEQRLRHEKHYKYVSTHDVAYWARSFDS
DLQRACKDHFSRRHWGIGFGMSFKVVALGPNFRRLSVEHIVPSYRRTENRLILLDYDGTV
MPENSIDRTPSSEVISVLNRLCEDPKNRVFIVSGRGKDELSRWFAPCEKLGIAAEHGYFT
RWSRDAPWEASALAADLDWKNTAEPVMRLYTEATDGSYIEHKESGMVWHHDEADPDFGSC
QAKELLDHLENVLANEPVVVKRGQHIVEVNPQGISKGVVVDSLLSSMVRTGKPPDFVLCI
GDDRSDEDMFESIVCPASSSGGVRLPASSEVFACTVGKKPSMAKYYLDDTVDVVKMLDGL
ASAPSPPRRPGPAAAVQLRVSFEGSL*

Other information
Ka divergence:0.152402KaKs divergence:0.0598958
GC content 1 (%):67GC content 2 (%):66GC content divergence:-0.008
Length 1 (bp):2556Length 2 (bp):2961Length divergence:0.073
MFE 1 (kcal):-1186.05MFE 2 (kcal):-1341.22MFE divergence0.061