Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122239-GRMZM2G178906
Species:maize
Duplication type:WGD
Function (paralog1):cysteine-type peptidase
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.87551269093671
Log2 mRNA fold difference:-0.40784965119524
Log2 TE fold difference:-0.48512807079182
Sequences
Protein sequence

MTHVFPREGASSSSTSMSSQRSETDDDRMIAMVLSEEYAKLDGAMAKRLTNLTSIPLVPR
INTYFPTYSDATMDHYRLLDRLNAYGLFEVRVSGDGNCQFRALSDQLYRSPDYHKNVRKE
IVKQLKECNSLYEGYVPMKYKHYCKKMKKYGEWGDHVTLQAAADKFAAKICLLTSFRDTC
FVEIVPQYQAPQREIWLSFWSEVHYNSLYDARDLPSKYKPRKKHWLLF*

MDHYRLLDRLNAYGLFEVRVSGDGNCQFRALSDQLYRSPDYHKHVRKEIVKQLKKCNTLY
EGYVPMKYKKYCKKMKKSGEWGDHVTLQAAADKFAAKICLLTSFRDTCFVEIVPQYQAPQ
REIWLSFWSEVHYNSLYDARGQKHIYLILLDLPSKYKPRKKHWLLF*

Other information
Ka divergence:0.506239KaKs divergence:0.511547
GC content 1 (%):41GC content 2 (%):39GC content divergence:-0.025
Length 1 (bp):687Length 2 (bp):501Length divergence:-0.157
MFE 1 (kcal):-185.72MFE 2 (kcal):-123.92MFE divergence-0.2