Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122615-GRMZM2G163843
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):no apical meristem protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.199993479611
Log2 mRNA fold difference:-0.48899588531826
Log2 TE fold difference:1.6287885944663
Sequences
Protein sequence

MTHSPLAAIKPPRPFFQSHPSHTELVDSYLRTWVEDGVKTGAFIHDADVYGSDPADLLQQ
FAPVVAHNGERAWYFYSLLRYKHSSGKRKKRSTGSGTWHSEAKPKPVFMASKSNWHQIGL
RQTFSFVVRNETGALFRTGWIMMEHRLLNDDGEEKQQEEEGFLVYRVLCKVYRSPRKPEP
SGNKAAAAASPGHKIEADDDESNDATLDENDDDESNDATLDENDDGSNAAPPAASGRKRK
SDDVEPSEAKASDVIAGGAAAAPAPKKKSDGSSSPVATSPTTEMQCPGCGHHVLVTMNRA
EPKSQTEIAKDESAPGARQQGEIRMYEFL*

MARPPSAALKPPYPAFQSHPSDLELVNFYLRPWVETGVKTGAFIHDADVYAADPNYLTRQ
FAPAVAQDGERAWYFYTPLRHKSVHGTRKTRTVATGGGCWHNEAKARPVYMVSNGMHQIA
HRQSFSFVEKDGGVRVRTGWLMMELRLVEDGAAGQKPEEDGALGSRVLCKVYRSPRNPEP
SGIEAATAPGQKAEADDDESCDDESSDATLDDDDSSNASLAAASGPKRESDEVESSDATV
AAPSRHSAPNDEISGGSAVAPGRKEKTEIGEVSTETSAAVRKRRKADGSSSPSTPVSTTD
MHCPQCGTHLMLTLNMAESKSEAGLAKDESATAAPDQGGTGESSQKNVRVRFHQFL*

Other information
Ka divergence:-0.416872KaKs divergence:-0.472956
GC content 1 (%):63GC content 2 (%):66GC content divergence:0.023
Length 1 (bp):990Length 2 (bp):1071Length divergence:0.039
MFE 1 (kcal):-414.61MFE 2 (kcal):-505.91MFE divergence0.099