Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122618-GRMZM5G828581
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192570
Function (paralog2):hypothetical protein LOC100193850

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.64143390526169
Log2 mRNA fold difference:-0.24892430764625
Log2 TE fold difference:-0.39068303220283
Sequences
Protein sequence

MSAGFQLGVIGSLALSVASSVAIVICNKALISTLGFPFATTLTSWHLMVTFCTLHVAHRL
HFFEPKAIDGQTVILFGLLNGTSIGLLNLSLGFNSIGFYQMTKLAIIPFTVLLETIFLNK
RFSESIKLSLLVLLLGVGIASITDLKLNMLGSILSGLAIATTCVGQILTNTIQKRLKVSS
TQLLYQSAPYQAGILFATGPFVDQLLTDRSVFAHKYSAPVLGFIVLSCLIAVSVNFSTFL
VIGTTSPVTYQVLGHLKTCLVLSFGYTLLHDPFTLRNILGILIAIFGMALYSYFSVREGK
KKSANDALPVSQMADKEAEPLLATKDNNDTKKANGLSHDC*

MAAGFQIGVIGSLALSVASSVSIVLCNKALISTLGFPFATTLTSWHLMVTFCTLHVAQRL
RFFEPKAIDGQTVILFGLLNGTSIGLLNLSLGFNSIGFYQMTKLAIIPFTVLLETIFLKK
RFSESIKLSLLVLLLGVGIASVTDLKLNLLGSILSGLAIATTCVGQILTNTIQKRLKVSS
TQLLYQSAPYQAAILFASGPFVDQLLTNRSVFAHKYSATVLGFIVLSCLIAVSVNFSTFL
VIGTTSPVTYQVLGHLKTCLVLSFGYTLLHDPFTLRNILGILIAIFGMALYSYFSVREGK
KKSANDALPVSQMPDKEVEPLLATKDSNDTEKANGLSHDC*

Other information
Ka divergence:0.0628096KaKs divergence:0.102893
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1023Length 2 (bp):1023Length divergence:0
MFE 1 (kcal):-307.78MFE 2 (kcal):-310.53MFE divergence0.004