Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122937-GRMZM2G116538
Species:maize
Duplication type:WGD
Function (paralog1):remorin
Function (paralog2):remorin

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAEEEAKKVEVEVTKEPEAAAKEDVADDKAVIPATDPPPPPPPADDSKALAIVEKVADEP
APEKPAPAKQGGSNDRDLALARVETEKRNSLIKAWEENEKTKAENKAAKKVSAILSWENT
KKANIEAELKKIEEQLEKKKAEYAEKMKNKVAMIHKEAEEKRAMVEAKRGEEVLKAEEMA
AKYRATGHAPKKLIGCFGA*

MTEEEAKKVEVEVEVTKAAPAKENAAEEKAVIPATEPPAAQEKPPAPADDSKALAIVEIA
DKSTPEKPIAEKQGGSSIRDLALARVETEKRNSLIKAWEDNEKAKADNKATKKVSVILSW
ENTKKANIEAEMKKIEEQLEKKKAEYAEKMKNKVAMIHREAEEKRAMVEAKRGEEVLKAE
EMAAKYRATGHAPKKPIGCFGA*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):600Length 2 (bp):609Length divergence:0.007
MFE 1 (kcal):-201.76MFE 2 (kcal):-193.65MFE divergence-0.021