Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G122965-GRMZM2G006341
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381956 (LOC100381956), mRNA
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSEAVAILSLSASAVVEDVLRQHGCRLSDRDLASRRAEEAAGRRNEAAGWLRRTVGAVAA
RDLPEEPSEEEFRLGLRNGQILCGALNRVHPGAVPKASAPCADGAALSAFQYFENVRNFL
VAAQEIGLPCFEASDLEQGGKSARVVNCVLALKSYGDWKQCGGTGPWKYGGNLKPSVSGK
SGHGRKNSEPFRRSQSINEGEVPYEEAGFNGDAHFDSSDMSTSRPLKMLVSAVLSDKRPD
EVPQLLESMLSKLVEEFENRLNSQNELVKAALKSGIDNTKSFSKSKVLVETPPNTSGRKM
DTGDIYCNHKKTKKEASREVALKQHLILQQQSKNVEELKSDLITTRAGMEYMQMKYSEDL
NLLGRHLFSLAHAASGYHKVLEENRKLYNQVQDLKGSIRVYCRVRPFLPGQASPSTVGSI
DEGNITIVTPSKSGKEGRKTFSFNKVFGPSATQAEVFLDTQPLIRSVLDGYNVCIFAYGQ
TGSGKTYTMSGPKNMTEQTQGVNYRALGDLFKLAEQRKGTFIYDIAVQMIEIYNEQVRDL
LVSDGLNKKYP*

MQLLESMLSKLVEEFENRLNSQNELVKAALKNGIDNTRSFSKSKVLVETTPNTSGRKMDT
ADIYCNHKQTKKVASSELALKQYSILQQQSKNVEELKSDLINTRDGMEYMQMKYAEDLNL
LGRHLFSLAHAASGYHKVLEENRKLYNQVQDLKGSIRVYCRVRPFLPGQASPSTVASIDE
GNITLVIPSKSGKEVRKTFSFNKVFGSSATQDEVFLDTQPLIRSVLDGYNVCIFAYGQTG
SGKTYTMSGPKNMTEQTQGVNYRALGDLFKLAEQRKRTFIYDIAVQMIEIYNEQVRDLLV
TDGLNKKYP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):40GC content divergence:-0.121
Length 1 (bp):1656Length 2 (bp):930Length divergence:-0.281
MFE 1 (kcal):-605.1MFE 2 (kcal):-257.63MFE divergence-0.403